Overview

URL https://supplementsbureau.com/the-backpack-electricity-system-review/
IP96.125.162.123
ASN
Location United States
Report completed2019-05-20 09:49:18 CEST
StatusLoading report..
urlquery Alerts No alerts detected


Settings

UserAgentMozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Referer
Pool
Access Level


Intrusion Detection Systems

Suricata /w Emerging Threats Pro  No alerts detected


Blacklists

MDL  No alerts detected
OpenPhish  No alerts detected
PhishTank  No alerts detected
Fortinet's Web Filter  No alerts detected
DNS-BH  No alerts detected
mnemonic secure dns  No alerts detected


Recent reports on same IP/ASN/Domain

Last 10 reports on IP: 96.125.162.123

Date UQ / IDS / BL URL IP
2019-06-15 12:52:11 +0200
0 - 0 - 0 https://i-review.net/lutenol-review/ 96.125.162.123
2019-06-15 11:13:00 +0200
0 - 0 - 0 https://shedextrapound.com/cinderella-solutio (...) 96.125.162.123
2019-06-15 10:44:27 +0200
0 - 0 - 0 https://i-review.net/unlock-your-hip-flexors- (...) 96.125.162.123
2019-06-15 07:19:42 +0200
0 - 0 - 0 https://supplementsbureau.com/yantra-manifest (...) 96.125.162.123
2019-06-14 12:46:09 +0200
0 - 0 - 0 https://shedextrapound.com/ez-battery-recondi (...) 96.125.162.123
2019-06-14 12:21:10 +0200
0 - 0 - 0 https://i-review.net/the-2-week-diet-review/ 96.125.162.123
2019-06-14 09:55:27 +0200
0 - 0 - 0 https://i-review.net/yantra-manifestation-review/ 96.125.162.123
2019-06-14 09:54:49 +0200
0 - 0 - 0 https://supplementsbureau.com/lutenol-review/ 96.125.162.123
2019-06-14 09:52:28 +0200
0 - 0 - 0 https://shedextrapound.com/lutenol-supplement (...) 96.125.162.123
2019-06-13 13:59:03 +0200
0 - 0 - 0 https://i-review.net/total-trim-11-review/ 96.125.162.123

Last 10 reports on ASN:

Date UQ / IDS / BL URL IP
2019-07-02 09:48:15 +0200
0 - 0 - 0 https://www.imdb.com/list/ls049696316/ 143.204.52.228
2019-07-02 09:48:17 +0200
0 - 0 - 0 https://www.imdb.com/list/ls049696333/ 143.204.52.228
2019-07-02 09:48:03 +0200
0 - 0 - 0 https://www.spreaker.com/show/ver-peru-x-urug (...) 52.51.101.146
2019-07-01 11:37:34 +0200
0 - 0 - 0 https://www.tig-uk.com/tts/nbn4298k3o7tvns8vp (...) 144.217.235.30
2019-07-01 11:37:22 +0200
0 - 0 - 0 https://www.tig-uk.com/tts/nbn4298k3o7tvns8vp (...) 144.217.235.30
2019-07-01 11:36:59 +0200
0 - 0 - 0 https://healthadviserpro.com/power-efficiency (...) 108.179.246.37
2019-07-01 11:35:37 +0200
0 - 0 - 0 https://www.imdb.com/list/ls049291106/ 143.204.52.228
2019-07-01 11:31:59 +0200
0 - 0 - 1 https://fp.bwjf.cn/downInvoice/98d3884f381b46 (...) 39.107.217.15
2019-07-01 11:28:01 +0200
0 - 0 - 0 https://d9.flashtalking.com/d9core 52.211.104.166
2019-07-01 11:27:51 +0200
0 - 0 - 0 https://www.launchora.com/story/123movies-wat (...) 52.38.238.5

Last 10 reports on domain: supplementsbureau.com

Date UQ / IDS / BL URL IP
2019-06-15 07:19:42 +0200
0 - 0 - 0 https://supplementsbureau.com/yantra-manifest (...) 96.125.162.123
2019-06-14 09:54:49 +0200
0 - 0 - 0 https://supplementsbureau.com/lutenol-review/ 96.125.162.123
2019-06-13 06:52:26 +0200
0 - 0 - 0 https://supplementsbureau.com/cinderella-solu (...) 96.125.162.123
2019-06-12 07:12:43 +0200
0 - 0 - 0 https://supplementsbureau.com/back-pain-break (...) 96.125.162.123
2019-06-11 13:35:36 +0200
0 - 0 - 0 https://supplementsbureau.com/blood-sugar-shi (...) 96.125.162.123
2019-06-10 07:22:11 +0200
0 - 0 - 0 https://supplementsbureau.com/ultra-omega-bur (...) 96.125.162.123
2019-06-07 11:23:27 +0200
0 - 0 - 0 https://supplementsbureau.com/panalean-review/ 96.125.162.123
2019-06-06 22:52:40 +0200
0 - 0 - 0 https://supplementsbureau.com/strictiond-review/ 96.125.162.123
2019-06-05 10:11:50 +0200
0 - 0 - 0 https://supplementsbureau.com/strictionbp-review/ 96.125.162.123
2019-06-04 12:37:28 +0200
0 - 0 - 0 https://supplementsbureau.com/the-bad-boy-blu (...) 96.125.162.123


JavaScript

Executed Scripts (54)


Executed Evals (0)


Executed Writes (0)



HTTP Transactions (96)


Request Response
                                        
                                            POST / HTTP/1.1 
Host: ocsp.int-x3.letsencrypt.org
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 117
Content-Type: application/ocsp-request

                                         
                                         91.135.34.19
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Server: nginx
Content-Length: 527
Etag: "50407B69E64DDE2258422650190A87A2958C17486854E32929198380E95689E8"
Last-Modified: Sat, 18 May 2019 06:00:00 UTC
Cache-Control: public, no-transform, must-revalidate, max-age=42593
Expires: Mon, 20 May 2019 19:38:38 GMT
Date: Mon, 20 May 2019 07:48:45 GMT
Connection: keep-alive


--- Additional Info ---
Magic:  data
Size:   527
Md5:    d6ae64f78f54fa99458aa302fbbdcf0f
Sha1:   823a13220225bea2e10a9fbabfdf1970437d0822
Sha256: 50407b69e64dde2258422650190a87a2958c17486854e32929198380e95689e8
                                        
                                            POST / HTTP/1.1 
Host: isrg.trustid.ocsp.identrust.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 115
Content-Type: application/ocsp-request

                                         
                                         91.135.34.26
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Server: Apache
Content-Transfer-Encoding: Binary
Last-Modified: Sat, 18 May 2019 23:17:07 GMT
Etag: "754ab58d9b16e78739e3cab73c0f3060dbd3b019"
Content-Length: 1398
Cache-Control: public, no-transform, must-revalidate, max-age=17702
Expires: Mon, 20 May 2019 12:43:47 GMT
Date: Mon, 20 May 2019 07:48:45 GMT
Connection: keep-alive


--- Additional Info ---
Magic:  data
Size:   1398
Md5:    1867df0dc89d4279caf0ecd57b067193
Sha1:   754ab58d9b16e78739e3cab73c0f3060dbd3b019
Sha256: 116c594e8e372069448c9236b77a844689c069a65240d9d1f52a05e7c3b8d393
                                        
                                            GET /the-backpack-electricity-system-review/ HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/html; charset=UTF-8
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:46 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: <https://supplementsbureau.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/paOgXk-1tG>; rel=shortlink
Set-Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857; path=/ thebackpackelectricitysystemreview=1; expires=Mon, 20-May-2019 07:53:46 GMT; Max-Age=300
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   33804
Md5:    41806396557151732cab193f1a8cb996
Sha1:   14aecf3f088233d05bf6e8aaa219ffd2b94550e4
Sha256: 75a88a2b58084797ee8e0d140da4ae6cb72fdb31fdc77723b13a7e2724e0687a
                                        
                                            POST / HTTP/1.1 
Host: ocsp.comodoca.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 116
Content-Type: application/ocsp-request

                                         
                                         151.139.128.14
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Date: Mon, 20 May 2019 07:48:48 GMT
Accept-Ranges: bytes
Last-Modified: Thu, 16 May 2019 16:11:41 GMT
Server: Apache
Etag: 3DF2BBA16C93213E6F0DD64F8465E18E4F0E2FB8
Cache-Control: max-age=302274,public,no-transform,must-revalidate
X-OCSP-Responder-ID: mcdpcaocsp10
X-HW: 1558338528.cds053.sk1.h2,1558338528.cds033.sk1.c
Connection: keep-alive
Content-Length: 472


--- Additional Info ---
Magic:  data
Size:   472
Md5:    615f9da50b173c1ee0ead682c168f004
Sha1:   3df2bba16c93213e6f0dd64f8465e18e4f0e2fb8
Sha256: 85d1f364a07e70cfaa07dc3d1a00b977976311682a699fa0d8cf7bdc3e00f482
                                        
                                            POST / HTTP/1.1 
Host: ocsp.comodoca.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 115
Content-Type: application/ocsp-request

                                         
                                         151.139.128.14
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Date: Mon, 20 May 2019 07:48:48 GMT
Accept-Ranges: bytes
Last-Modified: Wed, 15 May 2019 15:20:45 GMT
Server: Apache
Etag: FD333FFCB15A8F7D27CA20CD6DDBBC78BF028FAE
Cache-Control: max-age=302399,public,no-transform,must-revalidate
X-OCSP-Responder-ID: mcdpcaocsp1
X-HW: 1558338528.cds053.sk1.h2,1558338528.cds041.sk1.c
Connection: keep-alive
Content-Length: 727


--- Additional Info ---
Magic:  data
Size:   727
Md5:    9764693b7cc64dd12b4c150e4ab1fedd
Sha1:   fd333ffcb15a8f7d27ca20cd6ddbbc78bf028fae
Sha256: 2ea544580910753709d09f8903cbd01f11b1f6dc1b05874ce7e8ea5e4d91aad3
                                        
                                            POST / HTTP/1.1 
Host: ocsp.usertrust.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 115
Content-Type: application/ocsp-request

                                         
                                         151.139.128.14
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Date: Mon, 20 May 2019 07:48:48 GMT
Accept-Ranges: bytes
Last-Modified: Wed, 15 May 2019 15:20:45 GMT
Server: Apache
Etag: 73D83D448FA3E8835E45F2E1730811DB8B677C8E
Cache-Control: max-age=302399,public,no-transform,must-revalidate
X-OCSP-Responder-ID: mcdpcaocsp13
X-HW: 1558338528.cds032.sk1.h2,1558338528.cds047.sk1.c
Connection: keep-alive
Content-Length: 471


--- Additional Info ---
Magic:  data
Size:   471
Md5:    ff38d87460f0be278feefc0c10814ddc
Sha1:   73d83d448fa3e8835e45f2e1730811db8b677c8e
Sha256: 9da5368b5a8f1f0a3623c4e95e4f4879b2c267145d52bb4a06e1fb7815e0c3bc
                                        
                                            GET /wp-includes/js/wp-emoji-release.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 08 May 2019 06:36:13 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   5213
Md5:    ddafe0e4b78bdbc00bdcdb76729d8c0e
Sha1:   d1e7b2e92571a04de7b2389d361506c036398bf7
Sha256: 81a73eea6e092b23daa835a5a399696da3b7ce275a9658e2d49f608c7021adb8
                                        
                                            POST /GTSGIAG3 HTTP/1.1 
Host: ocsp.pki.goog
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 115
Content-Type: application/ocsp-request

                                         
                                         216.58.211.131
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Date: Mon, 20 May 2019 07:48:48 GMT
Cache-Control: public, max-age=86400
Server: ocsp_responder
Content-Length: 471
X-XSS-Protection: 0
X-Frame-Options: SAMEORIGIN


--- Additional Info ---
Magic:  data
Size:   471
Md5:    dead7ce66492156eb4813d9165af739f
Sha1:   b36f9e2adb9b52fd10a6afb457800fd90b1b0d45
Sha256: ee917e13ca30c1eb21800303c408f6b9b7555b2e1ce305b3b00ef3266744b73b
                                        
                                            POST /gsr2 HTTP/1.1 
Host: ocsp.pki.goog
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 112
Content-Type: application/ocsp-request

                                         
                                         216.58.211.131
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Date: Mon, 20 May 2019 07:48:48 GMT
Cache-Control: public, max-age=86400
Server: ocsp_responder
Content-Length: 468
X-XSS-Protection: 0
X-Frame-Options: SAMEORIGIN


--- Additional Info ---
Magic:  data
Size:   468
Md5:    5be872b3fe0bb6f31385f91f811e9586
Sha1:   1192231bcb9ee73e9f619d433cdb66dddd9ae7f7
Sha256: db0ad6191770bff9043482b68acf62a4e25d4390a03274cfbe413675dd8c9cf5
                                        
                                            GET /avatar/8b26c40980e3590aab27c855894ee4db?s=34&d=mm&r=g HTTP/1.1 
Host: secure.gravatar.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         192.0.73.2
HTTP/1.1 200 OK
Content-Type: image/jpeg
                                        
Server: nginx
Date: Mon, 20 May 2019 07:48:48 GMT
Content-Length: 1468
Connection: keep-alive
Last-Modified: Wed, 20 Mar 2019 09:04:37 GMT
Link: <https://www.gravatar.com/avatar/8b26c40980e3590aab27c855894ee4db?s=34&d=mm&r=g>; rel="canonical"
Content-Disposition: inline; filename="8b26c40980e3590aab27c855894ee4db.jpeg"
Access-Control-Allow-Origin: *
X-nc: HIT arn 2
Accept-Ranges: bytes
Expires: Mon, 20 May 2019 07:53:48 GMT
Cache-Control: max-age=300
Source-Age: 1380773


--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01, comment: "CREATOR: gd-jpeg v1.0 (using IJ"
Size:   1468
Md5:    c734cb76e8af4e471d5e1968281623f4
Sha1:   63f26529e2f1283681c6d26cec674884567a0034
Sha256: c78cfa6938afbdf1ad5a0a890fc6a3f1052c80272ad3cc3b4fe28131d1991ac8
                                        
                                            POST / HTTP/1.1 
Host: ocsp.godaddy.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 107
Content-Type: application/ocsp-request

                                         
                                         50.63.243.230
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Date: Mon, 20 May 2019 07:51:19 GMT
Server: Apache
Content-Transfer-Encoding: Binary
Cache-Control: max-age=118180, public, no-transform, must-revalidate
Last-Modified: Mon, 20 May 2019 06:24:39 GMT
Expires: Tue, 21 May 2019 18:24:39 GMT
Etag: "ec125a372b9c9866f9a913819a8e24df49ad5411"
P3P: CP="IDC DSP COR LAW CUR ADM DEV TAI PSA PSD IVA IVD HIS OUR SAM PUB LEG UNI COM NAV STA"
Content-Length: 1777
Connection: close


--- Additional Info ---
Magic:  data
Size:   1777
Md5:    06e92e827885ad4a5ed304566409a544
Sha1:   ec125a372b9c9866f9a913819a8e24df49ad5411
Sha256: 1d0d3026d01127ea55cac079f7938a0b9b11adbd25b0163cdfb68b5230535818
                                        
                                            GET /wp-content/plugins/table-of-contents-plus/screen.min.css?ver=1509 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 12 Dec 2018 06:21:18 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   476
Md5:    7d510f2dfdeb6086ca597504f305b1f6
Sha1:   f6d30281179fa9ea9b3b07c40ab6055dd7b66e0f
Sha256: ccf104c058b54813ab1c6bfe8995d9222b2d5d27424c23c63910caacf9d3aa08
                                        
                                            GET /css?family=Rubik%3A300%2C400%2C500%2C700%2C900%2C300italic%2C400italic%2C500italic%2C700italic%2C900italic&ver=1555399105 HTTP/1.1 
Host: fonts.googleapis.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         216.58.207.234
HTTP/1.1 200 OK
Content-Type: text/css; charset=utf-8
                                        
Access-Control-Allow-Origin: *
Timing-Allow-Origin: *
Expires: Mon, 20 May 2019 07:48:48 GMT
Date: Mon, 20 May 2019 07:48:48 GMT
Cache-Control: private, max-age=86400
Content-Encoding: gzip
Server: ESF
X-XSS-Protection: 0
X-Frame-Options: SAMEORIGIN
Alt-Svc: quic=":443"; ma=2592000; v="46,44,43,39"
Transfer-Encoding: chunked


--- Additional Info ---
Magic:  gzip compressed data, max compression
Size:   364
Md5:    de33a681f74fc3f2141214e6e4082462
Sha1:   1a6ad7a108a2d63cad14553e06a9aa3eaf65fee1
Sha256: 557a63a54ec7992f8ad678ff870b88aa505090a801bf1d1cd95f8443f9f4da68
                                        
                                            GET /e-201921.js HTTP/1.1 
Host: stats.wp.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         192.0.76.3
HTTP/1.1 200 OK
Content-Type: application/x-javascript
                                        
Server: nginx
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Etag: W/"5c6340e3-350a"
Content-Encoding: gzip
Expires: Mon, 18 May 2020 14:03:35 GMT
Cache-Control: max-age=31536000


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   2988
Md5:    643a135159ba2180596f86d70b473a23
Sha1:   ae939e21fdf62475da432641655cf8a514baa6a8
Sha256: 60221e140ad69f64a0cf9778fae386f532b2389f429e00463c4dfa38260b7a40
                                        
                                            GET /avatar/8b26c40980e3590aab27c855894ee4db?s=180&d=mm&r=g HTTP/1.1 
Host: secure.gravatar.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         192.0.73.2
HTTP/1.1 200 OK
Content-Type: image/jpeg
                                        
Server: nginx
Date: Mon, 20 May 2019 07:48:48 GMT
Content-Length: 12070
Connection: keep-alive
Last-Modified: Wed, 20 Mar 2019 09:04:37 GMT
Link: <https://www.gravatar.com/avatar/8b26c40980e3590aab27c855894ee4db?s=180&d=mm&r=g>; rel="canonical"
Content-Disposition: inline; filename="8b26c40980e3590aab27c855894ee4db.jpeg"
Access-Control-Allow-Origin: *
X-nc: HIT arn 4
Accept-Ranges: bytes
Expires: Mon, 20 May 2019 07:53:48 GMT
Cache-Control: max-age=300
Source-Age: 2186176


--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01, comment: "CREATOR: gd-jpeg v1.0 (using IJ"
Size:   12070
Md5:    0031af996c996041753411e2880536b4
Sha1:   5269acf810516d677948c12a453d884689499a33
Sha256: a0d76c4b0003eafa9595800f29cc8066fde20bd130e48c7467e838866535f0cd
                                        
                                            GET /js/gprofiles.js?ver=2019Mayaa HTTP/1.1 
Host: secure.gravatar.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         192.0.73.2
HTTP/1.1 200 OK
Content-Type: application/x-javascript
                                        
Server: nginx
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 23 Aug 2018 15:01:14 GMT
Etag: W/"5b7ecc3a-50bc"
Content-Encoding: gzip
Expires: Mon, 27 May 2019 07:48:48 GMT
Cache-Control: max-age=604800


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   6796
Md5:    188bd1f47794194d7d10beb193ebba87
Sha1:   330885f0d2ef8c026ee124500453bbafaf1957d9
Sha256: 6810c50037ff4eddf76da752b311153202ba5e2d1316e8749913967286a4708b
                                        
                                            GET /wp-content/js/devicepx-jetpack.js?ver=201921 HTTP/1.1 
Host: s0.wp.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         192.0.77.32
HTTP/1.1 200 OK
Content-Type: application/x-javascript
                                        
Server: nginx
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Etag: W/"5bffef56-52b6"
Content-Encoding: gzip
Expires: Mon, 18 May 2020 11:20:19 GMT
Cache-Control: max-age=31536000
X-ac: 4.arn _dca
X-nc: HIT arn 32


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   3163
Md5:    844b0e2ae8eba4159dd5edd8efbde50c
Sha1:   757861da25bea58b1bc03203f65ae93673cfc065
Sha256: ef84d445c23339e2c3742857d7e020c89d639f1ddc434b6f6a585ac9907bbb92
                                        
                                            GET /wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.1.1 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:44:20 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   704
Md5:    35eb0db64bb4390e08ff41ed8e55555d
Sha1:   e6e0994b1cb36f91b74ec1e6e8179da4ecd70e17
Sha256: 4f9aa713c9edba7f8170f749a044d9cc6fca6fbcb7b621a073e17a61b9966ef1
                                        
                                            GET /wp-content/plugins/accesspress-social-login-lite/css/font-awesome/font-awesome.min.css?ver=3.4.1 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 07 Mar 2019 09:45:26 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   7949
Md5:    7438a1154022437d28516126856bdc9c
Sha1:   02de5513d5eaa24de95874d298d91e7bfae82568
Sha256: 598f569294373e51127d419bcd5da11da3d104a6db21dc45fb7dc80fd7d2bd02
                                        
                                            GET /wp-includes/css/dist/block-library/style.min.css?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 08 May 2019 06:36:13 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   5891
Md5:    86c070b764a8f404fac6fe4b41d7e1ae
Sha1:   c40498227c0668da98c2c07bd960bb95ac3eec81
Sha256: 317cc56177bd1d9857c94524f4705f1d31a6c3b8a4756cfe5b6da53ccda10a94
                                        
                                            GET /wp-content/plugins/tnm-shortcode/css/shortcode.css?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:44:22 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   1355
Md5:    8311e8e7fec7f220316ef85a97d3b378
Sha1:   9ef5fa249e24f75556835cb657c9b9df2b5aa3f6
Sha256: a69c0ed6b01ba3016e87ee74501cc6925401391a8d94909dfe6f31b50203f388
                                        
                                            GET /wp-content/plugins/accesspress-social-login-lite/css/frontend.css?ver=3.4.1 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 07 Mar 2019 09:45:26 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   2405
Md5:    9a454215221620bcb8625007b98bec8b
Sha1:   2384b523f17c434a4fbdb0e0a5e22478d7ee5cff
Sha256: 7ef57a0a7143b6561aadf49880d4539fd0d78e39814f710f19002b956d73634d
                                        
                                            GET /wp-content/plugins/popup-anything-on-click/assets/css/popupaoc-public-style.css?ver=1.4.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 03 Apr 2019 11:06:31 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   5347
Md5:    cd844753a896d95c5ef16eecb681dea0
Sha1:   f44074c6aa0cc3bf32f500312ed3d4207a7467a0
Sha256: db7dad8ba647d31cad62d6b50e8bb22b54618da3d161ce9eb61d8b5f7d0a44f0
                                        
                                            GET /wp-content/plugins/wp-review/public/css/wp-review.css?ver=5.2.0 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 07 Mar 2019 09:45:37 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   6845
Md5:    b673be5fcadae908f6b4181aa713fa01
Sha1:   bc2eb9f8b0be47accfa5829dc0c80ada4341300e
Sha256: bc1a55b46e42868dfa5bdf9dc53daefeb763ecc6ea2c73735bff1bb87255d53e
                                        
                                            GET /wp-content/plugins/jetpack/css/jetpack.css?ver=7.3.1 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 16 May 2019 11:02:29 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   15908
Md5:    50d2ce985675c79b592aead69d47dc6f
Sha1:   41f27005029acdf854dd24242e872ba29d8c8bb5
Sha256: 25b75bb26be8e5e1533e78f0c2f6fbfa48bc653ec996c5c47a69446cc2e500a9
                                        
                                            GET /wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 15 Feb 2019 11:30:16 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   4306
Md5:    263da3c76e040de59141e13a36a27c8e
Sha1:   10bf87dfc02978dd1263fe427486376257f0d83c
Sha256: fa39bcd1ae1adf5df39a3e13c630e184f15ad85330112cb61e1ffcea4c55a376
                                        
                                            GET /wp-content/themes/the-next-mag/css/vendors.css?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   31995
Md5:    64c057b0df78f422cf85288a0f95f407
Sha1:   6eef84d285665691291da5c50d30124947116b1a
Sha256: b5af9ff418fb9c758931cb1e755e0dd8928c59d5ff61873926d207f0e45503d8
                                        
                                            GET /wp-content/plugins/accesspress-social-login-lite/js/frontend.js?ver=3.4.1 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 07 Mar 2019 09:45:26 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   144
Md5:    cbb93ef7839ac6f7f6b13116ee5baee3
Sha1:   3d0921b11c388f15f69a104950d324f3bf8153cf
Sha256: fcb13332387a361904aa3d87c59f2e723354e5f9810b52a5fc341034a82a9196
                                        
                                            GET /wp-includes/js/jquery/jquery.js?ver=1.12.4 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 22 Feb 2019 06:40:08 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   39403
Md5:    ee66b40e3ddfee912512fc9fde968c8b
Sha1:   048d3bc1ad05e3382bf470eebe0132c6d3df0c0f
Sha256: 5cb2c2c6cf60f8df0e3c5fa82d79677831b01af959477ec3a1bd62659a6976a8
                                        
                                            GET /wp-content/plugins/contact-form-7/includes/js/scripts.js?ver=5.1.1 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:44:20 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   4724
Md5:    14a4e1096d5a8cd3a743213a08d6fd05
Sha1:   c907d74f6f5e72c16b1f28327f27f95b4288dd0c
Sha256: 6a0dbc4d24410b0e7c32ace1ade685eda852a4bdecfb75ae4cb5b3b9b727aa5d
                                        
                                            GET /wp-content/plugins/table-of-contents-plus/front.min.js?ver=1509 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 12 Dec 2018 06:21:18 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   2505
Md5:    fdc3c05d5b86f2a42a38b4cc4c6bc458
Sha1:   d1e4f4767272709c8b636517c80855fccc31ed57
Sha256: 39e0823cd2b454c24142ac08685a405d842ad6af29a61dd08a2f211b0a1d4762
                                        
                                            GET /wp-content/plugins/thirstyaffiliates/js/app/ta.js?ver=3.8 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 03 Apr 2019 11:05:59 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   3010
Md5:    a46db0c37a1c8118be0a9649be976178
Sha1:   bc60deee675aaabb0190c60496892684231d771a
Sha256: 172aa65907a2b17dbd3665c0b81a2090f6a6c12c4ddd677c2b40fb3ff210020c
                                        
                                            GET /wp-content/plugins/tnm-shortcode/js/shortcode.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:44:22 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   619
Md5:    1eb89014584b59bb12ba90b3f3ad0571
Sha1:   9d5155614d7da1bbf966f872adc1a1ef71a2aa5c
Sha256: 774c4d0239841d0269def5c2cd8806ced1ae985ca392adcb15530680ea2fd6d6
                                        
                                            GET /wp-content/themes/the-next-mag/css/style.css?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: text/css
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   65999
Md5:    1b58c26b9a0d7ac0664f3d574347b1a3
Sha1:   d0272bb68347936681e6649a4b3a32ca215bdcae
Sha256: 39f0034b77ed93dcf0531c75de914b9894dc235b64b9121061f16bd18a737c78
                                        
                                            GET /wp-includes/js/jquery/ui/widget.min.js?ver=1.11.4 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 15 Feb 2019 11:30:16 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   2839
Md5:    a7a6b6e97241a5359e649033ce5312cb
Sha1:   0577683e4348681c73360344346c384d42fa9c93
Sha256: 23319489d61b1a6da52b0830fdc25173a65be2023b4570df063403ce4a7664e7
                                        
                                            GET /wp-content/plugins/jetpack/modules/wpgroho.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 16 May 2019 11:02:29 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   518
Md5:    492ebfb3e2ed38bbea6218f8c6e497c0
Sha1:   e77c5ec553919e9b2c1afac057cdc8bc34d24aba
Sha256: a7a61c25a85150b88ec9b22c3f9af5251f973b02f62ca85bd24e2e99992bc98e
                                        
                                            GET /wp-includes/js/jquery/ui/tabs.min.js?ver=1.11.4 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 15 Feb 2019 11:30:16 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   4450
Md5:    4eeeb29e5779c6cfe24a151b95b7fe15
Sha1:   bda2f624b89312d348159cb17dfcca32d0366961
Sha256: 696f11f9940d07f13f941c8367aece6da3682d6685934b63ad42de9fda7ae740
                                        
                                            GET /wp-includes/js/jquery/ui/core.min.js?ver=1.11.4 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 15 Feb 2019 11:30:16 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   1928
Md5:    c40ad6a990bce74a3ef62c99e6c23d0f
Sha1:   94b3115bb2c7ede039a0970eafefe0e8d66f8b63
Sha256: 72201b5ed1272a96e4dc7e9f3f53995f785f9824a159d06289b006e5211291fd
                                        
                                            GET /wp-includes/js/jquery/ui/accordion.min.js?ver=1.11.4 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 15 Feb 2019 11:30:16 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   3057
Md5:    c1252231692b0847dbb0eb2a7c6ad2f5
Sha1:   fa0432f59ee0bf84f6e3c3bbf2d72b0a902c9b4d
Sha256: da0449f6dd600f72ed0f596234ffc0bef79e7948011e8fb20a86ef9bc6ca0a2b
                                        
                                            POST /GTSGIAG3 HTTP/1.1 
Host: ocsp.pki.goog
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 115
Content-Type: application/ocsp-request

                                         
                                         216.58.211.131
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Date: Mon, 20 May 2019 07:48:51 GMT
Cache-Control: public, max-age=86400
Server: ocsp_responder
Content-Length: 471
X-XSS-Protection: 0
X-Frame-Options: SAMEORIGIN


--- Additional Info ---
Magic:  data
Size:   471
Md5:    372ad38bad3c92cc75403eed1d1b4b57
Sha1:   5e509cbf4d2281a4ba10102b32abd492cbb04a70
Sha256: 53a20108a1328e4ac37481c349e2f3c96865cebeec3309b219163785c476b3cc
                                        
                                            GET /wp-includes/js/masonry.min.js?ver=3.3.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 22 Feb 2019 06:40:07 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   9983
Md5:    a0c6973faed3479e260165a593bc5f3a
Sha1:   a772e43ba91d0aa7bb9a03ba021e5bce8b6e3c3a
Sha256: 7a0dde74e2ea1636c8ec9e93abf4fa35b8feabbf9074497af11cb7f7a1e04858
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/countdown.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   1777
Md5:    5e077d06a67973545d3e1ca1835a983d
Sha1:   739e311519bc85bf50f90be621734330101e21c9
Sha256: 0e059e8987f674fc55e04bce6ac7960855a03068222c295de8dbdd89dc4eff6c
                                        
                                            GET /wp-includes/js/imagesloaded.min.js?ver=3.2.0 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 22 Feb 2019 06:40:08 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   2861
Md5:    913f6ed9bb5a20e935ef6b37335abddc
Sha1:   53a99aa32cb389793681dbacfcf8cca7b96da2dd
Sha256: b34f2ec86bdc178a92dd72f59b64eed0db374c8b9f1b6fb5b8c22b29fff8fa86
                                        
                                            GET /wp-includes/js/jquery/jquery.masonry.min.js?ver=3.1.2b HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 15 Feb 2019 11:30:16 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   747
Md5:    89f7d97037fe4d0d4da92799c868cb6b
Sha1:   e840a58d817e75d3e695365242ba55bf4a929c60
Sha256: 1f3b36f860fcd6c9f1aa25fa72b8375f1ad7d19de6cefaa1c83b1b59ed574d18
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/throttle-debounce.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   468
Md5:    c1a6dddedf307e4ee2b96b86c9b28b5f
Sha1:   72e8799e04a9f43afad5a8960497e4c90e9275a6
Sha256: 346b02883453f3ebc7857c0cda8a61f5a4b6d75318f400af300a9b4eda9e8606
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/bootstrap.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:49 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   11810
Md5:    6d47c181fd47659518aa7fd63918b5d8
Sha1:   5cb8a1a379574a1153e53f830f46dd72164884df
Sha256: 18ad653901b48a3d13d6fa6984dfdb74a7e6a91cfac6cef7978a51bdcc935aa8
                                        
                                            GET /analytics.js HTTP/1.1 
Host: www.google-analytics.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         216.58.211.142
HTTP/1.1 200 OK
Content-Type: text/javascript
                                        
Strict-Transport-Security: max-age=10886400; includeSubDomains; preload
Timing-Allow-Origin: *
Date: Mon, 20 May 2019 07:27:28 GMT
Expires: Mon, 20 May 2019 09:27:28 GMT
Last-Modified: Thu, 02 May 2019 01:33:03 GMT
X-Content-Type-Options: nosniff
Vary: Accept-Encoding
Content-Encoding: gzip
Server: Golfe2
Content-Length: 17779
Cache-Control: public, max-age=7200
Age: 1286
Alt-Svc: quic=":443"; ma=2592000; v="46,44,43,39"


--- Additional Info ---
Magic:  gzip compressed data, max compression
Size:   17779
Md5:    348fbdd6c0fd83acfd390fa9cc127596
Sha1:   252099e50f60c46d3a16264edc93007ef333a660
Sha256: 5874a897424027f25efdc7142d4d8a4341d9a9f6362ac79bead10db6356dae2b
                                        
                                            POST /GTSGIAG3 HTTP/1.1 
Host: ocsp.pki.goog
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Content-Length: 115
Content-Type: application/ocsp-request

                                         
                                         216.58.211.131
HTTP/1.1 200 OK
Content-Type: application/ocsp-response
                                        
Date: Mon, 20 May 2019 07:48:54 GMT
Cache-Control: public, max-age=86400
Server: ocsp_responder
Content-Length: 471
X-XSS-Protection: 0
X-Frame-Options: SAMEORIGIN


--- Additional Info ---
Magic:  data
Size:   471
Md5:    f319c68db8667a56813a2ff79fbc49b1
Sha1:   5e6b3ac7e1bbc62546ba871052edf4bf6e6d2115
Sha256: aa1d7feb3b804032804f1c86ed2dedbe4950727252d43c8ae1c78b45dd58d212
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/flickity.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:54 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   16852
Md5:    bb9dcf2907bf767cfaeb416a7246737f
Sha1:   b12d2fb663540ab0b2a7b8f0d9b1c3b0150a6b85
Sha256: 329c864bb0e06dbed53b4d8c70e705939b0331ef94501756f056b21c727e9375
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/fotorama.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:54 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   17876
Md5:    6426780ae812e97f4578c6f4ce960eb3
Sha1:   f349bac66723ee3e9db63cae577b3cdfb50ef456
Sha256: a75d4a477fff2fd0680505e5ffd07a31c36c3fe2ae0304b4f8f69cf5bbba0f89
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/magnific-popup.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:54 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   8269
Md5:    febe0ce0fb006f2ba1dae58719f74d44
Sha1:   5814acfd1090c0eb7aac1c2664ac38a8780e811d
Sha256: 4518b9593ca4a41d6c5241b5f509b8952c3a2057dbc612efb47c2b07c471511c
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/owl-carousel.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:54 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   13244
Md5:    0b68eaab93fdab477c5bc4502ad6600e
Sha1:   d9a188f0fca4df2d2f618216d31cb065cc38f528
Sha256: faf0ca6e04742afe14db7478236a92a9cfc9711055dc27309fcd33d91ce00b21
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/perfect-scrollbar.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:54 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   7833
Md5:    fa99cdda749a9d6984540852eb8fa274
Sha1:   050fd033e6d744cc5c24ceffc8aebc1822fe918e
Sha256: 877f88e6672a9af4dcd5fab5343d9787f1b3d915c6d3d121bc00e200871b8174
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/theiaStickySidebar.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:54 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   1864
Md5:    3052a2786a784d5a72936a45b512b6cf
Sha1:   d8f70f139db88608837d7e8b849273cc69ed2734
Sha256: b893ceada26609c74cd3fbddc3929b9bf2f0518a8d05a7bc39ede64dd7046085
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/vticker.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   1777
Md5:    fbeeaa95fa66282e421e5f4e6244d609
Sha1:   c3113b6a560137b47f0a5c39d7dfdc2e75b54413
Sha256: 0cc08f8e34f3a32669f0678b4b8bc7c538d82386d56ac87c05aa75c1fd8a6d56
                                        
                                            GET /wp-content/themes/the-next-mag/js/vendors/fitvids.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   1383
Md5:    13628b42f090d909d7d299d50bfcc02b
Sha1:   e824fbde31ed662265309fe1d2df510b85586541
Sha256: 7dfb487f356a42ff44432a5b457618b53920b9bc67cefc00a1954d68b9550a95
                                        
                                            GET /wp-content/themes/the-next-mag/js/scripts.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:40 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   12485
Md5:    99b4342841a56e09b836426b64bbb5e1
Sha1:   2c995ae77818a70410ab2c7f11d118b1c8141819
Sha256: d346d8a5945fe8470b18c2437f6cb7b0b39d0bcc4c5ae42a8650f774f9e120ad
                                        
                                            GET /wp-includes/js/comment-reply.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 13 Mar 2019 06:36:50 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   1122
Md5:    7ba5255c47a6b95e2009cf4afdfce94a
Sha1:   d1244951f21d5f48cf61d61e2f7ab73c4607076a
Sha256: 8e5bb28844af0a9b284bcfdd3dd3b7dfa1c6e10b81e757fb488fb5c53e149c24
                                        
                                            GET /wp-content/plugins/wp-review/public/js/js.cookie.min.js?ver=2.1.4 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 07 Mar 2019 09:45:37 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   888
Md5:    7e2e43b23ea56b94f19a10ada61db9f9
Sha1:   6b38a93f98ee1e009b7166e25eb001eba5e83fa0
Sha256: 5963a23715f060cfd34e70fb18e26824d97f4f0dab31d5583318e782990ad2d8
                                        
                                            GET /wp-includes/js/underscore.min.js?ver=1.8.3 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 22 Feb 2019 06:40:08 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   6433
Md5:    2a1189ac2b45d1a01b3d231ffe7bca23
Sha1:   4b5f2c043409f2702dc1420b7c0a5c70fca60364
Sha256: 5ffa1e98ee6663b89378ce1965255ba9e2dad5b5a24fa4f6a3f92f6a09fb836f
                                        
                                            GET /s/rubik/v8/iJWKBXyIfDnIV7nBrXo.woff HTTP/1.1 
Host: fonts.gstatic.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://fonts.googleapis.com/css?family=Rubik%3A300%2C400%2C500%2C700%2C900%2C300italic%2C400italic%2C500italic%2C700italic%2C900italic&ver=1555399105
Origin: https://supplementsbureau.com

                                         
                                         216.58.207.227
HTTP/1.1 200 OK
Content-Type: font/woff
                                        
Accept-Ranges: bytes
Access-Control-Allow-Origin: *
Timing-Allow-Origin: *
Content-Length: 27516
Date: Fri, 19 Apr 2019 15:31:01 GMT
Expires: Sat, 18 Apr 2020 15:31:01 GMT
Last-Modified: Tue, 19 Feb 2019 22:39:33 GMT
X-Content-Type-Options: nosniff
Server: sffe
X-XSS-Protection: 0
Cache-Control: public, max-age=31536000
Age: 2650674
Alt-Svc: quic=":443"; ma=2592000; v="46,44,43,39"


--- Additional Info ---
Magic:  data
Size:   27516
Md5:    80a9477d95ed5ca6e64843c1024e9e7f
Sha1:   ab20dfee5e5bd8f72029cd07858a2260dcc3ef5f
Sha256: ee00d4f5e7ceaded8f18955244249de93c2d337554ed2b1fe5181620d4b5a6c7
                                        
                                            GET /s/rubik/v8/iJWHBXyIfDnIV7Eyjmmd8WY.woff HTTP/1.1 
Host: fonts.gstatic.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://fonts.googleapis.com/css?family=Rubik%3A300%2C400%2C500%2C700%2C900%2C300italic%2C400italic%2C500italic%2C700italic%2C900italic&ver=1555399105
Origin: https://supplementsbureau.com

                                         
                                         216.58.207.227
HTTP/1.1 200 OK
Content-Type: font/woff
                                        
Accept-Ranges: bytes
Access-Control-Allow-Origin: *
Timing-Allow-Origin: *
Content-Length: 28248
Date: Fri, 19 Apr 2019 15:24:33 GMT
Expires: Sat, 18 Apr 2020 15:24:33 GMT
Last-Modified: Tue, 19 Feb 2019 22:40:35 GMT
X-Content-Type-Options: nosniff
Server: sffe
X-XSS-Protection: 0
Cache-Control: public, max-age=31536000
Age: 2651062
Alt-Svc: quic=":443"; ma=2592000; v="46,44,43,39"


--- Additional Info ---
Magic:  data
Size:   28248
Md5:    bec9243368f86e688b23bc1852823d0b
Sha1:   3d8366812e739d43c78f7f34fc24ed87adb266a1
Sha256: 25bfee01217a77eeb6906db4834535fc034e09f8dadef54d37cd0278dc569be7
                                        
                                            GET /wp-includes/js/wp-util.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 15 Feb 2019 11:30:16 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   586
Md5:    a700dac6e9515ac3634e2e1b3932a758
Sha1:   5f1b3117b8eaf15ee2c7a33488e57c82cb96530c
Sha256: f93a972e47934f47e2cd797c476978dbe54172307cb27a8ff039f537bffca020
                                        
                                            GET /wp-content/plugins/wp-review/public/js/main.js?ver=5.2.0 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 07 Mar 2019 09:45:37 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   1376
Md5:    7fcccc5ad57db9e9695987f17959b444
Sha1:   df851255932cb5cbaa3a8c817ae511c1a4ac1df3
Sha256: 91e7a41989e9045785107fca5258bf9b59300e7dd0ef89ae941d9828871cce83
                                        
                                            GET /wp-includes/js/wp-embed.min.js?ver=5.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Fri, 15 Feb 2019 11:30:16 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   767
Md5:    fe6243ad6b87f904a1a3495c3188e768
Sha1:   cedd6d98559aa2ad591b306ded0d13241704fef0
Sha256: 1235e5add5817020528b1c972b43ebaded6a1a4cff631158360ab36a7b9f6449
                                        
                                            GET /wp-content/plugins/jetpack/_inc/build/spin.min.js?ver=1.3 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 16 May 2019 11:02:29 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   2314
Md5:    f90146f45e83dfe0b4cd7cb3d159c44c
Sha1:   649a3fdc5a07a71b8464625fbbde96cb4be409ff
Sha256: 0ecd1f802d0521daa45fa126fe6ca0410dfbb5e94bcf3919a36e320b3da6afe4
                                        
                                            GET /wp-content/plugins/jetpack/_inc/build/jquery.spin.min.js?ver=1.3 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 16 May 2019 11:02:29 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   722
Md5:    8a39ae75b749287b053eb2135dea78ad
Sha1:   bf8cea8a0cfc33df3d6a44b7c6fc6e5904218996
Sha256: ff2f6d0806846a97c5b06c43464d8e35fb8ac191255410b80f4e6b9c05fdc95d
                                        
                                            GET /wp-content/plugins/jetpack/_inc/build/carousel/jetpack-carousel.min.js?ver=20190102 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:55 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 16 May 2019 11:02:29 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   9253
Md5:    0f8c5be3ce1b64a153f101256361bfdc
Sha1:   c26fe5c81009286c85b97b77c089f63b8be97be9
Sha256: 575a3ac04192eddce3dd4b05fe60f28bd42b2e889b9f3cc1ef62a01468fd93a6
                                        
                                            GET /wp-content/plugins/akismet/_inc/form.js?ver=4.1.2 HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: application/javascript
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 16 May 2019 11:02:04 GMT
Content-Encoding: gzip


--- Additional Info ---
Magic:  gzip compressed data, from Unix
Size:   326
Md5:    4b23391af71976e4b5430a4ffaafb84c
Sha1:   ad97da1917da96883aa6da853a00deb11662a9f2
Sha256: 91adb72fecb5c55d2b89ee648e3de40831d3dd611b2e005d4e1769fd06c37555
                                        
                                            GET /wp-content/themes/the-next-mag/fonts/mdicon.ttf?1qswia HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/wp-content/themes/the-next-mag/css/style.css?ver=5.2
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: font/ttf
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 15832
Connection: keep-alive
Last-Modified: Tue, 05 Feb 2019 04:42:41 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  TrueType font data\012 raw G3 data, byte-padded
Size:   15832
Md5:    6523a8212b0d9be7fb7dbeb6d6cb0635
Sha1:   5ae56e6e5d3ef7c1ccdb5ff80b2c7163e6953e99
Sha256: 41961eb9e8787489bf7cdb2cc200741edd327c62d55832a446fb40b673b5d32a
                                        
                                            GET /wp-content/plugins/wp-review/public/fonts/font-icons.woff HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/wp-content/plugins/wp-review/public/css/wp-review.css?ver=5.2.0
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: font/woff
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 2872
Connection: keep-alive
Last-Modified: Thu, 07 Mar 2019 09:45:37 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  data
Size:   2872
Md5:    a89184a5fb7946e62474db33ed5592d3
Sha1:   56d85e45c82e7dd3fd95cb11c9fe5d18625f5b9f
Sha256: d075970d07bf4f5152cff1fd11f5161b50313cb8570cf11375b5558e70e33f9a
                                        
                                            GET /wp-content/uploads/2019/03/SB-1.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 35802
Connection: keep-alive
Last-Modified: Fri, 15 Mar 2019 07:56:31 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 500 x 99, 8-bit/color RGBA, non-interlaced
Size:   35802
Md5:    97e85e12e9777867d5f29f076e44a1cf
Sha1:   54ccdef32c7de4829d8abf591ebfe8823007e810
Sha256: 5afdbdc51b00f4737e5c60620a543303a250b8a71eb5f294b8d3ce16b29ac69c
                                        
                                            GET /s/rubik/v8/iJWEBXyIfDnIV7nEnX660g.woff HTTP/1.1 
Host: fonts.gstatic.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://fonts.googleapis.com/css?family=Rubik%3A300%2C400%2C500%2C700%2C900%2C300italic%2C400italic%2C500italic%2C700italic%2C900italic&ver=1555399105
Origin: https://supplementsbureau.com

                                         
                                         216.58.207.227
HTTP/1.1 200 OK
Content-Type: font/woff
                                        
Accept-Ranges: bytes
Access-Control-Allow-Origin: *
Timing-Allow-Origin: *
Content-Length: 28716
Date: Fri, 19 Apr 2019 15:24:56 GMT
Expires: Sat, 18 Apr 2020 15:24:56 GMT
Last-Modified: Tue, 19 Feb 2019 22:39:42 GMT
X-Content-Type-Options: nosniff
Server: sffe
X-XSS-Protection: 0
Cache-Control: public, max-age=31536000
Age: 2651040
Alt-Svc: quic=":443"; ma=2592000; v="46,44,43,39"


--- Additional Info ---
Magic:  data
Size:   28716
Md5:    f778b3151e4b3ed5b831e9e8646ab207
Sha1:   2de1c3da0bef9f79bae90a314f783d6aeb406695
Sha256: 491e888a8ac356422b9767a9ad0b14c5c8cfef8d3a2c88f8e0971e57d1e527a2
                                        
                                            GET /wp-content/uploads/2019/05/The-Backpack-Electricity-System-Scam-or-Legit.jpeg HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/jpeg
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 27876
Connection: keep-alive
Last-Modified: Wed, 15 May 2019 11:42:18 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01
Size:   27876
Md5:    dc1989724f5acc39a571b7567eb02521
Sha1:   741f11e5a5055e06a82f93c1a3d6c92f5c677034
Sha256: 971bac06f267d334345de79ca7672259cfd21da04e37afb783c7512c64d5cc70
                                        
                                            GET /wp-content/uploads/2019/05/The-Backpack-Electricity-System-Customer-Reviews-.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 27946
Connection: keep-alive
Last-Modified: Wed, 15 May 2019 11:42:59 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 387 x 191, 8-bit/color RGB, non-interlaced
Size:   27946
Md5:    2b02517d326ce2515743ac88f640a190
Sha1:   94de30e2ea866c3a7dd04ebdd2425bc5ce1e9459
Sha256: a8ced2c8b79cd476a251a277390991fb16cf467ef42c64a5e7ad96d3237eb7e3
                                        
                                            GET /wp-content/uploads/2019/05/Wealth-Activation-Blueprint-Guide-180x180.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 49763
Connection: keep-alive
Last-Modified: Wed, 15 May 2019 05:24:11 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 180 x 180, 8-bit/color RGBA, non-interlaced
Size:   49763
Md5:    40c0d439395921ae786544afc42f3e70
Sha1:   7986e802c334464cf47f5352230586b540783c02
Sha256: f047788861204d8f9cede57ddbfa79ca7edc1dde3f50e33d4876c9b134569ecb
                                        
                                            GET /g.gif?v=ext&j=1%3A7.3.1&blog=159744942&post=5684&tz=0&srv=supplementsbureau.com&host=supplementsbureau.com&ref=&fcp=0&rand=0.49438860904448145 HTTP/1.1 
Host: pixel.wp.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         192.0.76.3
HTTP/1.1 200 OK
Content-Type: image/gif
                                        
Server: nginx
Date: Mon, 20 May 2019 07:48:57 GMT
Content-Length: 50
Connection: keep-alive
Cache-Control: no-cache


--- Additional Info ---
Magic:  GIF image data, version 89a, 6 x 5
Size:   50
Md5:    e4d673a55c5656f19ef81563fb10884c
Sha1:   1f2d8ed221d39329251ad3a6ff1edb20b7219443
Sha256: f3a8992acb9ab911e0fa4ae12f4b85ef8e61008619f13ee51c7a121ff87f63b1
                                        
                                            GET /r/collect?v=1&_v=j75&a=901363307&t=pageview&_s=1&dl=https%3A%2F%2Fsupplementsbureau.com%2Fthe-backpack-electricity-system-review%2F&ul=en-us&de=UTF-8&dt=The%20Backpack%20Electricity%20System%20Review%20-%20Build%20Your%20Own%20Portable%20Generator%20That%20Generates%20Power%20Easily!!&sd=24-bit&sr=1176x885&vp=1159x754&je=1&fl=10.0%20r45&_u=IEBAAEQ~&jid=170791326&gjid=1045724227&cid=544072560.1558338535&tid=UA-135902334-13&_gid=2070298615.1558338535&_r=1&z=1913068276 HTTP/1.1 
Host: www.google-analytics.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/

                                         
                                         216.58.211.142
HTTP/1.1 200 OK
Content-Type: image/gif
                                        
Access-Control-Allow-Origin: *
Date: Mon, 20 May 2019 07:48:56 GMT
Pragma: no-cache
Expires: Fri, 01 Jan 1990 00:00:00 GMT
Cache-Control: no-cache, no-store, must-revalidate
Last-Modified: Sun, 17 May 1998 03:00:00 GMT
X-Content-Type-Options: nosniff
Server: Golfe2
Content-Length: 35
Alt-Svc: quic=":443"; ma=2592000; v="46,44,43,39"


--- Additional Info ---
Magic:  GIF image data, version 89a, 1 x 1
Size:   35
Md5:    28d6814f309ea289f847c69cf91194c6
Sha1:   0f4e929dd5bb2564f7ab9c76338e04e292a42ace
Sha256: 8337212354871836e6763a41e615916c89bac5b3f1f0adf60ba43c7c806e1015
                                        
                                            GET /s/rubik/v8/iJWHBXyIfDnIV7F6iGmd8WY.woff HTTP/1.1 
Host: fonts.gstatic.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://fonts.googleapis.com/css?family=Rubik%3A300%2C400%2C500%2C700%2C900%2C300italic%2C400italic%2C500italic%2C700italic%2C900italic&ver=1555399105
Origin: https://supplementsbureau.com

                                         
                                         216.58.207.227
HTTP/1.1 200 OK
Content-Type: font/woff
                                        
Accept-Ranges: bytes
Access-Control-Allow-Origin: *
Timing-Allow-Origin: *
Content-Length: 28216
Date: Fri, 19 Apr 2019 15:33:53 GMT
Expires: Sat, 18 Apr 2020 15:33:53 GMT
Last-Modified: Tue, 19 Feb 2019 22:44:01 GMT
X-Content-Type-Options: nosniff
Server: sffe
X-XSS-Protection: 0
Cache-Control: public, max-age=31536000
Age: 2650504
Alt-Svc: quic=":443"; ma=2592000; v="46,44,43,39"


--- Additional Info ---
Magic:  data
Size:   28216
Md5:    29b164482600fc3976b5b2c863d69b71
Sha1:   944c4b0d5b82c02c8f715263edfedb4279d9a454
Sha256: 6893b01508e8a7c8fa049115ad90b727b8990d43d38676df5e4c4be36fbbffc7
                                        
                                            GET /wp-content/uploads/2019/05/Language-Of-Desire-Review--180x180.jpg HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/jpeg
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:57 GMT
Content-Length: 10074
Connection: keep-alive
Last-Modified: Thu, 09 May 2019 08:30:05 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01
Size:   10074
Md5:    ab671239475c35e2ab541cc4cdc58b54
Sha1:   2644a76e28254c9dfbb635ebc1a4b1e41cd86c9e
Sha256: e4738dabe99f7f080e6d47d5703c44a62b1576d1c98dded28583918af19f8fe9
                                        
                                            GET /wp-content/uploads/2019/05/The-Lost-Ways-Review-180x180.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:57 GMT
Content-Length: 70383
Connection: keep-alive
Last-Modified: Fri, 10 May 2019 03:50:47 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 180 x 180, 8-bit/color RGBA, non-interlaced
Size:   70383
Md5:    11be5702399d6fd0b39c114d832c86bc
Sha1:   6bb0cadd6a098d31892a5ad858bdb3278c112858
Sha256: 959f7de1965d144a2c9692290c1418fe0ce20490cfb52d9c4bbad80d68e80866
                                        
                                            GET /wp-content/uploads/2019/05/The-Backpack-Electricity-System-Does-It-Work.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 228888
Connection: keep-alive
Last-Modified: Wed, 15 May 2019 11:39:36 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 730 x 563, 8-bit/color RGB, non-interlaced
Size:   228888
Md5:    9615743dbd7a2142dc82726f66fe3ae1
Sha1:   b85e314da1d3c8490aa4dac9b65d8017eefae8c0
Sha256: 6f2e77b1d3d5624eee281ac58eacca23fca0bf896f8726a7e31d6d525c315ac6
                                        
                                            GET /wp-content/uploads/2019/05/The-Backpack-Electricity-System-Book.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 243400
Connection: keep-alive
Last-Modified: Wed, 15 May 2019 11:38:50 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 362 x 450, 8-bit/color RGBA, non-interlaced
Size:   243400
Md5:    1ece24b77dfa98cdba92f046c2e8146e
Sha1:   44b0a3284c63c58a222e4e1baf27ff5e488a66f7
Sha256: ccc8dec4cd0e49b9bd74c93220caa5b7e727fca7b8560b267ab2cce4f2a30adb
                                        
                                            GET /wp-content/uploads/2019/04/1_av0FNN7nu6d_lG5y8XYSEg-1024x576-400x300.jpeg HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/jpeg
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:57 GMT
Content-Length: 24359
Connection: keep-alive
Last-Modified: Fri, 26 Apr 2019 08:02:58 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01
Size:   24359
Md5:    af5082aa4c08bf386214c9330b6f5f1a
Sha1:   93fe4eb2e344d829936a1030c7aaf20e9e80f2db
Sha256: fbb13966a6e76df49344de6b371b4cea41f0a97ae65b9710aa23b85b2b652308
                                        
                                            GET /wp-content/uploads/2019/05/turmalima-FB-post-1-180x180.jpg HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/jpeg
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:57 GMT
Content-Length: 13574
Connection: keep-alive
Last-Modified: Thu, 16 May 2019 07:12:17 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01
Size:   13574
Md5:    ece183b61e9c08c3ef90fa37832a019a
Sha1:   0b9e085e6454235aa11f8cfa724206349b1adad3
Sha256: 41ee997223c168109f0ad6e8712ac747684669d49ebd1c589a60d4eb3e5272a1
                                        
                                            GET /wp-content/uploads/2019/05/The-Backpack-Electricity-System-Review-.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:56 GMT
Content-Length: 287766
Connection: keep-alive
Last-Modified: Wed, 15 May 2019 11:38:02 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 593 x 522, 8-bit/color RGBA, non-interlaced
Size:   287766
Md5:    a5053c54d3abc614bc606d8238a8e96a
Sha1:   b312899d8fb32c4d7aef8d893d33e912c4b20f4b
Sha256: 44c0cd30100f69068b6c340c4981b646109cc87dc84d2670325162b6a5430788
                                        
                                            GET /wp-content/uploads/2019/03/Auto-Lotto-Processor-Review-400x300.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:57 GMT
Content-Length: 88592
Connection: keep-alive
Last-Modified: Wed, 27 Mar 2019 09:29:32 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 400 x 300, 8-bit/color RGBA, non-interlaced
Size:   88592
Md5:    9823537c350f4ffb190f34740935b42c
Sha1:   3df29549a3f43440a56db4f3dba95a63fcc28f97
Sha256: a18c9759628f4c6887edc383235b568b2d7b0e0767d23d105221046af9e49b5c
                                        
                                            GET /wp-content/uploads/2019/03/Awaken-The-Species-Review-400x300.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:57 GMT
Content-Length: 146365
Connection: keep-alive
Last-Modified: Sat, 23 Mar 2019 10:37:58 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 400 x 300, 8-bit/color RGBA, non-interlaced
Size:   146365
Md5:    26cd4edeb4a1dd0b8936f53aaad36395
Sha1:   70a36a92abf9b93a9b45e077cc7874311906116a
Sha256: 9daee1f7d3d7d278c3e5cd72abd02d27c69742d3a27397d2035c7bbb996f70a4
                                        
                                            GET /wp-content/uploads/2019/05/ketogenesis-1-180x180.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:58 GMT
Content-Length: 36130
Connection: keep-alive
Last-Modified: Sat, 11 May 2019 08:37:51 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 180 x 180, 8-bit/color RGBA, non-interlaced
Size:   36130
Md5:    7b88bfce1a43988ae092d8f15fd06c66
Sha1:   e8fe11128ce3b31d22618ef7b47b2b5233398999
Sha256: b35cdf14e1a6e5c6e9aadb8f51a4638a70d09b88fd2dc5ed23f4f8e1c3285279
                                        
                                            GET /wp-content/uploads/2019/03/Curafen-Ingredients-Review-180x180.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:58 GMT
Content-Length: 40217
Connection: keep-alive
Last-Modified: Fri, 22 Mar 2019 10:29:44 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 180 x 180, 8-bit/color RGBA, non-interlaced
Size:   40217
Md5:    2e01133ad6e230a7976427b140967100
Sha1:   2366c1279ba3aea1df2775efda3ff8ae61c0c158
Sha256: 6504ddac9195d385e6884f3822d986d690c30661e0b24dba654f6eabf8a195d9
                                        
                                            GET /wp-content/uploads/2019/03/cropped-DoS_DS_Seal-copy-32x32.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:58 GMT
Content-Length: 3157
Connection: keep-alive
Last-Modified: Fri, 15 Mar 2019 07:55:23 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 32 x 32, 8-bit/color RGBA, non-interlaced
Size:   3157
Md5:    f8121d5a8f7d43e93890406cb6321aea
Sha1:   e178f2f5f2bd277d6cee5322a81d55d3829684c6
Sha256: 887f94729a7a4c2eab1e347069fbb5b964781afe70d1f18b5effecd2a11ce154
                                        
                                            GET /wp-content/uploads/2019/05/turmalima-FB-post-1-400x225.jpg HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/jpeg
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:58 GMT
Content-Length: 21488
Connection: keep-alive
Last-Modified: Thu, 16 May 2019 07:12:17 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01
Size:   21488
Md5:    37fd580f259a5aa291643104133db0ad
Sha1:   b82d4486c83a3e21677dd5f1f48ee1048eade5fe
Sha256: f99a383921281e079f452c5629bf6e1292363aa74e5c6476662e97f0c323c3d5
                                        
                                            GET /wp-content/uploads/2019/05/The-Backpack-Electricity-System-Review--180x180.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:58 GMT
Content-Length: 44193
Connection: keep-alive
Last-Modified: Wed, 15 May 2019 11:38:04 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 180 x 180, 8-bit/color RGBA, non-interlaced
Size:   44193
Md5:    166fcc6b0f02e6a636c333a93f7a5b91
Sha1:   9c635bc289a031a0458b908e10cc62dc977b6932
Sha256: 5a7301bb66228c43d369f7e13d3d2a6e7d8e7006250123150f2e7d65c8bc29bc
                                        
                                            GET /wp-content/uploads/2019/03/cropped-DoS_DS_Seal-copy-192x192.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:58 GMT
Content-Length: 46601
Connection: keep-alive
Last-Modified: Fri, 15 Mar 2019 07:55:23 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 192 x 192, 8-bit/color RGBA, non-interlaced
Size:   46601
Md5:    73537d1d5bfe3a63acb1341edec8b696
Sha1:   a925b088e328d562b9281e5b06843b05b9834c20
Sha256: 32f034918401c503bebfba8a0bb495c594aa8a91588379376ad0150f15b72ee3
                                        
                                            GET /wp-content/uploads/2019/05/Wealth-Activation-Blueprint-Guide-400x225.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Referer: https://supplementsbureau.com/the-backpack-electricity-system-review/
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         96.125.162.123
HTTP/1.1 200 OK
Content-Type: image/png
                                        
Server: nginx/1.14.1
Date: Mon, 20 May 2019 07:48:58 GMT
Content-Length: 99303
Connection: keep-alive
Last-Modified: Wed, 15 May 2019 05:24:11 GMT
Accept-Ranges: bytes


--- Additional Info ---
Magic:  PNG image, 400 x 225, 8-bit/color RGBA, non-interlaced
Size:   99303
Md5:    77fa890335daed0f90a187ddd9e5ec1b
Sha1:   ee766c2d725233587b8e83a4c0834f9695094f01
Sha256: 7eca4f7870a356281859bd52da6e698bdc02c747a48ab0f0649484327227bd33
                                        
                                            GET /wp-content/uploads/2019/03/cropped-DoS_DS_Seal-copy-32x32.png HTTP/1.1 
Host: supplementsbureau.com
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PHPSESSID=0d0c334be217985b4ba3344a7cd23857

                                         
                                         0.0.0.0
                                        


--- Additional Info ---