Overview

URL chriskemp.net/img/logos.gif?1508c=172312
IP94.136.40.82
ASNAS20738 Webfusion Internet Solutions
Location United Kingdom
Report completed2018-04-19 02:22:11 CEST
StatusLoading report..
urlQuery Alerts No alerts detected


Settings

UserAgentMozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Referer
Pool
Access Level


Intrusion Detection Systems

Suricata /w Emerging Threats Pro  No alerts detected


Blacklists

MDL  No alerts detected
OpenPhish  No alerts detected
PhishTank  No alerts detected
Fortinet's Web Filter
Added / Verified Severity Host Comment
2018-04-19 2 chriskemp.net/img/logos.gif?1508c=172312 Malware
DNS-BH  No alerts detected
mnemonic secure dns  No alerts detected


Recent reports on same IP/ASN/Domain

Last 10 reports on IP: 94.136.40.82

Date UQ / IDS / BL URL IP
2018-10-17 10:46:34 +0200
0 - 0 - 0 best-network.co.uk 94.136.40.82
2018-10-05 03:50:41 +0200
0 - 0 - 1 lincsdogtraining.com/ 94.136.40.82
2018-10-04 11:36:16 +0200
0 - 0 - 1 hannahreade.co.uk/FSS/10.htm 94.136.40.82
2018-10-01 17:47:00 +0200
0 - 0 - 1 rutherford.me.uk/ 94.136.40.82
2018-09-30 23:31:57 +0200
0 - 0 - 1 mayfordathletic.co.uk/w 94.136.40.82
2018-09-30 16:43:59 +0200
0 - 0 - 2 hedelmittmns.whitecliffsprimarycollege.org/fo (...) 94.136.40.82
2018-09-30 16:38:58 +0200
0 - 0 - 2 hedelmittmns.whitecliffsprimarycollege.org/bo (...) 94.136.40.82
2018-09-29 15:37:30 +0200
0 - 0 - 1 pamjonesconsultancy.co.uk/ 94.136.40.82
2018-09-29 06:51:17 +0200
0 - 0 - 2 gruisgroefqtc.darkfairy.org.uk/board/viewthre (...) 94.136.40.82
2018-09-29 06:51:04 +0200
0 - 0 - 2 gruisgroefqtc.darkfairy.org.uk/forum/index.php 94.136.40.82

Last 10 reports on ASN: AS20738 Webfusion Internet Solutions

Date UQ / IDS / BL URL IP
2018-10-18 20:49:19 +0200
0 - 0 - 0 web301.extendcp.co.uk 176.32.230.45
2018-10-18 18:07:43 +0200
0 - 0 - 0 79.170.44.91/sherwoodstemp.co.uk/wp-content/u (...) 79.170.44.91
2018-10-17 20:29:27 +0200
0 - 0 - 0 web301.extendcp.co.uk 176.32.230.45
2018-10-17 15:42:10 +0200
0 - 0 - 0 aviva.pl 46.32.252.2
2018-10-17 14:45:18 +0200
0 - 0 - 0 absolutepleasureyacht.com 37.122.210.189
2018-10-17 10:46:34 +0200
0 - 0 - 0 best-network.co.uk 94.136.40.82
2018-10-17 07:51:16 +0200
0 - 0 - 3 familylawbarrister.org/ 176.32.230.24
2018-10-16 17:31:47 +0200
0 - 0 - 0 powertransmissiondistribution.co.uk 94.136.40.51
2018-10-16 11:25:29 +0200
0 - 0 - 0 79.170.44.95/geens.co.uk/wp-content/uploads/u (...) 79.170.44.95
2018-10-15 21:44:35 +0200
0 - 0 - 0 www.burningtheclocks.co.uk/wp-content/plugins (...) 217.199.187.198

Last 10 reports on domain: chriskemp.net

Date UQ / IDS / BL URL IP
2018-10-12 20:07:30 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 54.144.21.246
2018-10-10 13:09:43 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 52.87.45.42
2018-10-05 07:07:03 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 52.87.45.42
2018-10-04 04:07:07 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 52.6.46.72
2018-10-03 09:07:10 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 52.87.45.42
2018-10-01 00:59:40 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 52.5.251.20
2018-09-28 22:58:58 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 52.5.251.20
2018-09-27 09:07:01 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 52.6.46.72
2018-08-12 04:46:39 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 109.68.33.64
2018-08-10 23:59:33 +0200
0 - 0 - 1 chriskemp.net/img/logos.gif?1508c=172312 109.68.33.64


JavaScript

Executed Scripts (0)


Executed Evals (0)


Executed Writes (0)



HTTP Transactions (2)


Request Response
                                        
                                            GET /img/logos.gif?1508c=172312 HTTP/1.1 
Host: chriskemp.net
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive

                                         
                                         94.136.40.82
HTTP/1.1 302 Found
                                        
Cache-Control: private
Location: http://81.21.76.62/chriskemp.net/index.html
Server: Microsoft-IIS/7.5
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
Date: Thu, 19 Apr 2018 00:21:37 GMT
Content-Length: 0


--- Additional Info ---

Alerts:
  Blacklists:
    - fortinet: Malware
                                        
                                            GET /chriskemp.net/index.html HTTP/1.1 
Host: 81.21.76.62
                                        
User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) Gecko/20101203 Firefox/3.6.13
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive

                                         
                                         0.0.0.0
                                        


--- Additional Info ---