
URL messepost-online.de/dispute/americafirstcom/
Location Canada
Report completed2022-09-30 22:08:56 UTC
StatusLoading report..
urlquery Alerts No alerts detected


UserAgentMozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0

Intrusion Detection Systems

Suricata /w Emerging Threats Pro  No alerts detected


Scan Date Severity Indicator Comment
2022-09-30 2 messepost-online.de/dispute/americafirstcom/ America First Credit Union
2022-09-30 2 messepost-online.de/dispute/americafirstcom/ America First Credit Union
PhishTank  No alerts detected
Fortinet's Web Filter
Scan Date Severity Indicator Comment
2022-09-30 2 messepost-online.de/dispute/americafirstcom/ Phishing
2022-09-30 2 messepost-online.de/dispute/americafirstcom/ Phishing
2022-09-30 2 messepost-online.de/dispute/americafirstcom/asset/analytics/ads/js/actions.js Phishing
2022-09-30 2 messepost-online.de/dispute/americafirstcom/adobe/data/js/css/index_1.html Phishing
2022-09-30 2 messepost-online.de/dispute/americafirstcom/adobe/data/js/css/roboto-latin- (...) Phishing
2022-09-30 2 messepost-online.de/dispute/americafirstcom/adobe/data/js/css/roboto-latin- (...) Phishing
mnemonic secure dns  No alerts detected
Quad9 DNS  No alerts detected


No files detected

Passive DNS (12)

Passive DNS Source Fully Qualifying Domain Name Rank First Seen Last Seen IP Comment
mnemonic passive DNS r3.o.lencr.org (4) 344 2020-12-02 08:52:13 UTC 2022-09-30 04:55:29 UTC
mnemonic passive DNS content-signature-2.cdn.mozilla.net (1) 1152 2020-11-03 12:26:46 UTC 2022-09-30 05:34:07 UTC
mnemonic passive DNS ocsp.digicert.com (3) 86 2012-05-21 07:02:23 UTC 2022-09-30 15:21:19 UTC
mnemonic passive DNS code.jquery.com (2) 634 2012-05-21 17:28:02 UTC 2022-09-30 05:18:50 UTC
mnemonic passive DNS push.services.mozilla.com (1) 2140 2015-09-03 10:29:36 UTC 2022-09-30 05:12:28 UTC
mnemonic passive DNS img-getpocket.cdn.mozilla.net (6) 1631 2017-09-01 03:40:57 UTC 2022-09-30 13:49:02 UTC
mnemonic passive DNS firefox.settings.services.mozilla.com (2) 867 2020-05-27 20:08:30 UTC 2022-09-30 17:00:01 UTC
mnemonic passive DNS messepost-online.de (16) 0 2016-09-30 09:38:55 UTC 2022-09-30 22:08:23 UTC Unknown ranking
mnemonic passive DNS contile.services.mozilla.com (1) 1114 2021-05-27 18:32:35 UTC 2022-09-30 04:56:26 UTC
mnemonic passive DNS cdnjs.cloudflare.com (2) 235 2020-10-20 10:17:36 UTC 2022-09-30 06:01:15 UTC
mnemonic passive DNS ajax.aspnetcdn.com (1) 693 2012-05-24 13:35:31 UTC 2022-09-30 13:56:54 UTC
mnemonic passive DNS stackpath.bootstrapcdn.com (1) 2467 2018-04-05 04:41:29 UTC 2022-09-30 11:00:19 UTC

Recent reports on same IP/ASN/Domain/Screenshot

Last 3 reports on IP:

2022-10-08 15:27:02 +0000
0 - 0 - 4 messepost-online.de/dispute/americafirstcom/
2022-09-30 22:09:01 +0000
0 - 0 - 10 messepost-online.de/dispute/americafirstcom
2022-09-30 22:08:56 +0000
0 - 0 - 8 messepost-online.de/dispute/americafirstcom/

Last 5 reports on ASN: DIGI VPS

2022-11-22 06:42:57 +0000
0 - 0 - 6 virginiadullaws.com/
2022-11-21 23:25:22 +0000
0 - 0 - 2 southerncross.rockinghamvirginiatrafficlawyer.com/
2022-11-12 08:51:30 +0000
0 - 0 - 1 gangdefense.info/
2022-11-02 12:52:14 +0000
0 - 0 - 1 entaer-takarek.cyou/takarek/login.html
2022-10-31 21:54:34 +0000
0 - 0 - 1 ackitia-takarek.cyou/takarek/loginkd.html

Last 3 reports on domain: messepost-online.de

2022-10-08 15:27:02 +0000
0 - 0 - 4 messepost-online.de/dispute/americafirstcom/
2022-09-30 22:09:01 +0000
0 - 0 - 10 messepost-online.de/dispute/americafirstcom
2022-09-30 22:08:56 +0000
0 - 0 - 8 messepost-online.de/dispute/americafirstcom/

Last 5 reports with similar screenshot

2022-12-09 12:54:14 +0000
0 - 0 - 7 inmobiliariajm.hn/americanfirst
2022-12-09 02:25:52 +0000
0 - 0 - 6 thiemens21.fc.school/wp-admin/Utah-afcu/afcu/
2022-12-09 02:05:37 +0000
0 - 0 - 7 laurapotterdesigns.com/americafirst
2022-12-06 12:33:35 +0000
0 - 0 - 6 mail.barnhillcreativecounseling.com/securelog (...)
2022-12-06 12:29:31 +0000
0 - 0 - 8 mail.barnhillcreativecounseling.com/securelog (...)


Executed Scripts (10)

Executed Evals (0)

Executed Writes (0)

HTTP Transactions (40)

Request Response
                                            GET /v1/ HTTP/1.1 
Host: firefox.settings.services.mozilla.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Sec-Fetch-Dest: empty
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/1.1 200 OK
Content-Type: application/json
Content-Length: 939
Connection: keep-alive
Access-Control-Allow-Origin: *
Access-Control-Expose-Headers: Content-Type, Alert, Backoff, Retry-After, Content-Length
Cache-Control: max-age=3600
Content-Security-Policy: default-src 'none'; frame-ancestors 'none'; base-uri 'none';
Date: Fri, 30 Sep 2022 21:16:15 GMT
X-Content-Type-Options: nosniff
X-Cache: Hit from cloudfront
Via: 1.1 a034aae43a19aef875fa395182990970.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: OSL50-C1
X-Amz-Cf-Id: 03xZNi4-1SPJvaOjfiImuj-65HHBvi-B34zIcnv-8mXi2T7eFZYhSg==
Age: 3150

--- Additional Info ---
Magic:  JSON data\012- , ASCII text, with very long lines (939), with no line terminators
Size:   939
Md5:    2d12f67fe57a87e7366b662d153a5582
Sha1:   d7b02d81cc74f24a251d9363e0f4b0a149264ec1
Sha256: 73c273c0b5a2de3cb970b8e8c187999d3b55e760dc7766dab4bb76428d19b551
                                            POST / HTTP/1.1 
Host: r3.o.lencr.org
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate
Content-Type: application/ocsp-request
Content-Length: 85
Connection: keep-alive
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/ocsp-response
Server: nginx
Content-Length: 503
ETag: "763E2DADFDD286A51327CD2000CA335E30CD0B9B7267875D22CA33F7556BA200"
Last-Modified: Fri, 30 Sep 2022 09:00:00 UTC
Cache-Control: public, no-transform, must-revalidate, max-age=3872
Expires: Fri, 30 Sep 2022 23:13:17 GMT
Date: Fri, 30 Sep 2022 22:08:45 GMT
Connection: keep-alive

                                            GET /chains/remote-settings.content-signature.mozilla.org-2022-10-30-18-47-44.chain HTTP/1.1 
Host: content-signature-2.cdn.mozilla.net
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Sec-Fetch-Dest: empty
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: binary/octet-stream
content-length: 5348
last-modified: Sat, 10 Sep 2022 18:47:45 GMT
content-disposition: attachment
accept-ranges: bytes
server: AmazonS3
date: Fri, 30 Sep 2022 05:28:28 GMT
etag: "6113f8408c59aebe188d6af273b90743"
x-cache: Hit from cloudfront
via: 1.1 a6d89f7e2d55548b941f1ff5d5b3c8d4.cloudfront.net (CloudFront)
x-amz-cf-pop: OSL50-C1
x-amz-cf-id: 3BYRvE3qL4H2znRAIXWc1M5-kcdB2Z6q8uahYZOg0WdIAS1zfJYPLA==
age: 60018
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  PEM certificate\012- , ASCII text
Size:   5348
Md5:    6113f8408c59aebe188d6af273b90743
Sha1:   7398873bf00f99944eaa77ad3ebc0d43c23dba6b
Sha256: b6e0cc9ad68306208a160f3835fb8da76acc5a82d8fde1da5a98e1de1c11a770
                                            GET /dispute/americafirstcom/ HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,image/avif,image/webp,*/*;q=0.8
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate
Connection: keep-alive
Upgrade-Insecure-Requests: 1

HTTP/1.1 301 Moved Permanently
Content-Type: text/html; charset=iso-8859-1
Date: Fri, 30 Sep 2022 22:08:44 GMT
Server: Apache
Location: https://messepost-online.de/dispute/americafirstcom/
Content-Length: 260
Keep-Alive: timeout=5, max=100
Connection: Keep-Alive

--- Additional Info ---
Magic:  HTML document text\012- HTML document text\012- HTML document text\012- HTML document text\012- HTML document text\012- exported SGML document, ASCII text
Size:   260
Md5:    7fa9defd34cbce30684252a9852817af
Sha1:   7a0c27fa1f671899d8e206eb7a6da801d0e48fe8
Sha256: d8504cd5ea00462c384a4b788da0cc3ea65a76f9eb120e8e092d640761ada1bc

    - openphish: America First Credit Union
    - fortinet: Phishing
                                            GET /v1/tiles HTTP/1.1 
Host: contile.services.mozilla.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Sec-Fetch-Dest: empty
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: application/json
server: nginx
date: Fri, 30 Sep 2022 22:08:45 GMT
content-length: 12
strict-transport-security: max-age=31536000
via: 1.1 google
alt-svc: clear
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  JSON data\012- , ASCII text, with no line terminators
Size:   12
Md5:    23e88fb7b99543fb33315b29b1fad9d6
Sha1:   a48926c4ec03c7c8a4e8dffcd31e5a6cdda417ce
Sha256: 7d8f1de8b7de7bc21dfb546a1d0c51bf31f16eee5fad49dbceae1e76da38e5c3
                                            GET /v1/buckets/main/collections/ms-language-packs/records/cfr-v1-en-US HTTP/1.1 
Host: firefox.settings.services.mozilla.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: application/json
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Content-Type: application/json
Connection: keep-alive
Sec-Fetch-Dest: empty
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/1.1 200 OK
Content-Type: application/json
Content-Length: 329
Connection: keep-alive
Access-Control-Allow-Origin: *
Access-Control-Expose-Headers: ETag, Expires, Content-Length, Cache-Control, Pragma, Content-Type, Alert, Backoff, Last-Modified, Retry-After
Content-Security-Policy: default-src 'none'; frame-ancestors 'none'; base-uri 'none';
Last-Modified: Fri, 25 Mar 2022 17:45:46 GMT
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
Date: Fri, 30 Sep 2022 21:29:33 GMT
Cache-Control: max-age=3600, max-age=3600
Expires: Fri, 30 Sep 2022 22:12:13 GMT
ETag: "1648230346554"
X-Cache: Hit from cloudfront
Via: 1.1 a9120cc3ff449047c990e82a4d5566ba.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: OSL50-C1
X-Amz-Cf-Id: bq23nJIOkFc_c8UTMX2YpJNsQNZnx2b4ucRFG_dPiJ7DbqtvDAzF3w==
Age: 2352

--- Additional Info ---
Magic:  JSON data\012- , ASCII text, with very long lines (329), with no line terminators
Size:   329
Md5:    0333b0655111aa68de771adfcc4db243
Sha1:   63f295a144ac87a7c8e23417626724eeca68a7eb
Sha256: 60636eb1dc67c9ed000fe0b49f03777ad6f549cb1d2b9ff010cf198465ae6300
                                            POST / HTTP/1.1 
Host: ocsp.digicert.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate
Content-Type: application/ocsp-request
Content-Length: 83
Connection: keep-alive
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/ocsp-response
Accept-Ranges: bytes
Age: 4144
Cache-Control: 'max-age=158059'
Date: Fri, 30 Sep 2022 22:08:45 GMT
Last-Modified: Fri, 30 Sep 2022 20:59:41 GMT
Server: ECS (ska/F71E)
X-Cache: HIT
Content-Length: 471

                                            GET /dispute/americafirstcom/ HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,image/avif,image/webp,*/*;q=0.8
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Upgrade-Insecure-Requests: 1
Sec-Fetch-Dest: document
Sec-Fetch-Mode: navigate
Sec-Fetch-Site: none
Sec-Fetch-User: ?1

HTTP/1.1 200 OK
Content-Type: text/html
Date: Fri, 30 Sep 2022 22:08:45 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 13:14:06 GMT
Accept-Ranges: bytes
Content-Length: 33357
Keep-Alive: timeout=5, max=100
Connection: Keep-Alive

--- Additional Info ---
Magic:  HTML document text\012- HTML document text\012- HTML document text\012- HTML document text\012- HTML document text\012- HTML document text\012- HTML document text\012- exported SGML document text\012- exported SGML document, Unicode text, UTF-8 text, with very long lines (3970), with CRLF line terminators
Size:   33357
Md5:    636a0d5c4650abe144994004f31833c9
Sha1:   3998a1e7e881f5a619fba6aecccb8f56c3c601fd
Sha256: 65cd35a0af166f01c3713a184e0c3a27e735986cc1e8b59929ba174dc401d0c3

    - openphish: America First Credit Union
    - fortinet: Phishing
                                            GET /ajax/libs/popper.js/1.14.0/umd/popper.min.js HTTP/1.1 
Host: cdnjs.cloudflare.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: https://messepost-online.de
Connection: keep-alive
Referer: https://messepost-online.de/
Sec-Fetch-Dest: script
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: application/javascript; charset=utf-8
date: Fri, 30 Sep 2022 22:08:46 GMT
content-length: 6458
access-control-allow-origin: *
cache-control: public, max-age=30672000
content-encoding: br
etag: "5eb03fa9-500f"
last-modified: Mon, 04 May 2020 16:15:37 GMT
cf-cdnjs-via: cfworker/kv
cross-origin-resource-policy: cross-origin
timing-allow-origin: *
x-content-type-options: nosniff
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
vary: Accept-Encoding
cf-cache-status: HIT
age: 7618973
expires: Wed, 20 Sep 2023 22:08:46 GMT
accept-ranges: bytes
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=aHaoY7QdLmTg0DgSFAJXa9yNbPsgJzweY8EWoAzWTVCcrF%2FZAIBDuvoDlYdxekAvldcJJVUDoxGjFfgVaNg3ttC7iirF0tczX5jZ8WIcuBz0n4waHAqPIij9Kul2D89NT4yPIQTT"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0.01,"report_to":"cf-nel","max_age":604800}
strict-transport-security: max-age=15780000
server: cloudflare
cf-ray: 753047707a9b1c06-OSL
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  ASCII text, with very long lines (20322)
Size:   6458
Md5:    df9fe6d48e380554eb0ec9687bed3246
Sha1:   207263d754220200c1916edfbda262f62223ecf5
Sha256: 91d57502b7260e6752c2b5f1636d77707929fa9f09da28589691e61816a448f9
                                            POST / HTTP/1.1 
Host: ocsp.digicert.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate
Content-Type: application/ocsp-request
Content-Length: 83
Connection: keep-alive
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/ocsp-response
Accept-Ranges: bytes
Age: 2323
Cache-Control: 'max-age=158059'
Date: Fri, 30 Sep 2022 22:08:46 GMT
Last-Modified: Fri, 30 Sep 2022 21:30:03 GMT
Server: ECS (ska/F71E)
X-Cache: HIT
Content-Length: 279

                                            GET /ajax/libs/jquery.mask/1.14.10/jquery.mask.js HTTP/1.1 
Host: cdnjs.cloudflare.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/
Sec-Fetch-Dest: script
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: application/javascript; charset=utf-8
date: Fri, 30 Sep 2022 22:08:46 GMT
content-length: 4517
access-control-allow-origin: *
cache-control: public, max-age=30672000
content-encoding: br
etag: "5eb03ec3-4e98"
last-modified: Mon, 04 May 2020 16:11:47 GMT
cf-cdnjs-via: cfworker/kv
cross-origin-resource-policy: cross-origin
timing-allow-origin: *
x-content-type-options: nosniff
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
vary: Accept-Encoding
cf-cache-status: HIT
age: 3290912
expires: Wed, 20 Sep 2023 22:08:46 GMT
accept-ranges: bytes
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=rqcK%2B95Fy5pSR3f6hImanPYcEWEN156HGqO6gRQnGqfGDaJfcoQhYIBhVGCq4quCMQQqTZUKy3soJMZ4Hble8b3quYqnymF3x7x6JPoYNRh%2FUK%2BdIE0q6J7CICb%2BrpQkI9MNQgNr"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0.01,"report_to":"cf-nel","max_age":604800}
strict-transport-security: max-age=15780000
server: cloudflare
cf-ray: 753047709b9c0b49-OSL
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  ASCII text
Size:   4517
Md5:    e40e054c5726f042bad463e3774a2777
Sha1:   5c9413b72837a440b327444104830c35ae3b052c
Sha256: fcc8a86d2e89e8fbe9815d50c23bf205191ab8a6c0bec67358cd975d94283ff8
                                            GET /jquery-3.3.1.slim.min.js HTTP/1.1 
Host: code.jquery.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: https://messepost-online.de
Connection: keep-alive
Referer: https://messepost-online.de/
Sec-Fetch-Dest: script
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: application/javascript; charset=utf-8
date: Fri, 30 Sep 2022 22:08:46 GMT
content-encoding: gzip
content-length: 24038
last-modified: Fri, 20 Aug 2021 17:47:53 GMT
accept-ranges: bytes
server: nginx
etag: W/"611feac9-1111d"
cache-control: max-age=315360000, public
access-control-allow-origin: *
vary: Accept-Encoding
x-hw: 1664575726.dop212.sk1.t,1664575726.cds020.sk1.hn,1664575726.cds230.sk1.c
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  ASCII text, with very long lines (65247)
Size:   24038
Md5:    0f2e7d37e730fdbb1d8a1e8638529ecb
Sha1:   c21d16978a858baa75be15cb7e799ff000929429
Sha256: cc938c08b93e67c94c68995709f52133c62cac78991f42058503b9c3d9e4b0b0
                                            GET /jquery-3.2.1.min.js HTTP/1.1 
Host: code.jquery.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/
Sec-Fetch-Dest: script
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: application/javascript; charset=utf-8
date: Fri, 30 Sep 2022 22:08:46 GMT
content-encoding: gzip
content-length: 30125
last-modified: Fri, 20 Aug 2021 17:47:53 GMT
accept-ranges: bytes
server: nginx
etag: W/"611feac9-15283"
cache-control: max-age=315360000, public
access-control-allow-origin: *
vary: Accept-Encoding
x-hw: 1664575726.dop232.sk1.t,1664575726.cds228.sk1.hn,1664575726.cds222.sk1.c
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  ASCII text, with very long lines (32058)
Size:   30125
Md5:    148f8d3ffd9cc02048c5f4d1cc83c407
Sha1:   9f2b89cfd151be6a29b4d43ad64d164fb8471046
Sha256: 4dc681da48ba2b417e613e8e027ff5322963c3a3697a8ba97973cfefb48def5e
                                            GET /ajax/jQuery/jquery-3.3.1.min.js HTTP/1.1 
Host: ajax.aspnetcdn.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/
Sec-Fetch-Dest: script
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: application/javascript
content-encoding: gzip
accept-ranges: bytes
access-control-allow-origin: *
age: 17577221
cache-control: public,max-age=31536000
date: Fri, 30 Sep 2022 22:08:46 GMT
etag: "80288516b793d31:0"
last-modified: Mon, 22 Jan 2018 19:27:49 GMT
server: ECAcc (ska/F7A8)
timing-allow-origin: *
vary: Accept-Encoding
x-cache: HIT
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
content-length: 30394
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  ASCII text, with very long lines (65451)
Size:   30394
Md5:    a263be51483c81a54aa8c85104a93e55
Sha1:   555a54a73531c553bd2aede6abc25c128b63312e
Sha256: b2f13ad730928958c09d89e6e32bb6a227c0260d032a39ca464d998a59e57a66
                                            GET / HTTP/1.1 
Host: push.services.mozilla.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Sec-WebSocket-Version: 13
Origin: wss://push.services.mozilla.com/
Sec-WebSocket-Protocol: push-notification
Sec-WebSocket-Extensions: permessage-deflate
Sec-WebSocket-Key: hyDupnrKMhJMTORLEAgk+Q==
Connection: keep-alive, Upgrade
Sec-Fetch-Dest: websocket
Sec-Fetch-Mode: websocket
Sec-Fetch-Site: cross-site
Pragma: no-cache
Cache-Control: no-cache
Upgrade: websocket

HTTP/1.1 101 Switching Protocols
Connection: Upgrade
Upgrade: websocket
Sec-WebSocket-Accept: z7T2y06unXyMp8puVhK2g81ytjs=

                                            POST / HTTP/1.1 
Host: ocsp.digicert.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate
Content-Type: application/ocsp-request
Content-Length: 83
Connection: keep-alive
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/ocsp-response
Accept-Ranges: bytes
Age: 2323
Cache-Control: 'max-age=158059'
Date: Fri, 30 Sep 2022 22:08:46 GMT
Last-Modified: Fri, 30 Sep 2022 21:30:03 GMT
Server: ECS (ska/F71E)
X-Cache: HIT
Content-Length: 279

                                            GET /dispute/americafirstcom/adobe/data/js/css/app.76ff82e5.css HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: text/css,*/*;q=0.1
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: style
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: text/css
Date: Fri, 30 Sep 2022 22:08:45 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 2555
Keep-Alive: timeout=5, max=100
Connection: Keep-Alive

--- Additional Info ---
Magic:  ASCII text, with very long lines (2555), with no line terminators
Size:   2555
Md5:    45fdfaabff062b120c343417bdb06350
Sha1:   332147dbfd8ffbb33144494cc90abe385ed6dff2
Sha256: ff7c1455abe0a7bc7da593da4f46d258b47b70c61cd37b2f2890f8063930d034
                                            GET /dispute/americafirstcom/asset/analytics/ads/js/style.css HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: text/css,*/*;q=0.1
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: style
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: text/css
Date: Fri, 30 Sep 2022 22:08:45 GMT
Server: Apache
Last-Modified: Tue, 16 Nov 2021 14:01:14 GMT
Accept-Ranges: bytes
Content-Length: 414
Keep-Alive: timeout=5, max=100
Connection: Keep-Alive

--- Additional Info ---
Magic:  ASCII text, with CRLF line terminators
Size:   414
Md5:    f9653fbeecf34b04791fee59eb3e253b
Sha1:   fcbbad7c6616682a22a9d0de09d715c61cb17722
Sha256: 7924e7e8b95825e4cefbfc31444ea9247e1b0d04cb066b56f06addf9cc7c5eaf
                                            GET /dispute/americafirstcom/asset/analytics/ads/js/actions.js HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: script
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: application/javascript
Date: Fri, 30 Sep 2022 22:08:45 GMT
Server: Apache
Last-Modified: Mon, 21 Feb 2022 15:29:04 GMT
Accept-Ranges: bytes
Content-Length: 1340
Keep-Alive: timeout=5, max=100
Connection: Keep-Alive

--- Additional Info ---
Magic:  ASCII text, with CRLF line terminators
Size:   1340
Md5:    bfef294446761f81225bda51229dfdad
Sha1:   930cedeac977eb7ad969772600deffaff8174dc0
Sha256: 3006a7f5d160a928d4f8fe1572e645d91201447f88257ed27022ff07beffb8dd

    - fortinet: Phishing
                                            GET /dispute/americafirstcom/adobe/data/js/css/index_1.html HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,image/avif,image/webp,*/*;q=0.8
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Upgrade-Insecure-Requests: 1
Sec-Fetch-Dest: iframe
Sec-Fetch-Mode: navigate
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: text/html
Date: Fri, 30 Sep 2022 22:08:45 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:56 GMT
Accept-Ranges: bytes
Content-Length: 7069
Keep-Alive: timeout=5, max=100
Connection: Keep-Alive

--- Additional Info ---
Magic:  HTML document text\012- HTML document text\012- HTML document text\012- HTML document text\012- HTML document text\012- exported SGML document, ASCII text, with very long lines (550)
Size:   7069
Md5:    cdb27a0a2c3b25c23454a4454c2c78d6
Sha1:   c7ed38e2a97b9033975cb81cc63b0031b93a3a2f
Sha256: b5d1cc340a095d374fe03137d3b45a6b8772ab148672d13e3d15ffb3d94db019

    - fortinet: Phishing
                                            GET /dispute/americafirstcom/adobe/data/js/css/chunk-vendors.eab46e62.css HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: text/css,*/*;q=0.1
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: style
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: text/css
Date: Fri, 30 Sep 2022 22:08:45 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 716803
Keep-Alive: timeout=5, max=99
Connection: Keep-Alive

--- Additional Info ---
Magic:  Unicode text, UTF-8 text, with very long lines (60387)
Size:   716803
Md5:    fa58619b967a7b4a132981b548401f8d
Sha1:   abd8234b95cc2bf19fa27f3afa472beb7ce3aa9d
Sha256: dd66ac6aaff011d49ba95602e75d12741be4e1cdb6a3ab587233a5f5879a6eae
                                            GET /dispute/americafirstcom/adobe/data/js/css/21d7d23b5082cfbd7662ecf888a9879cef5e3b6d.png HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: image
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: image/png
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 1998
Keep-Alive: timeout=5, max=99
Connection: Keep-Alive

--- Additional Info ---
Magic:  PNG image data, 55 x 62, 8-bit/color RGBA, non-interlaced\012- data
Size:   1998
Md5:    ae659b5597c9500445cc6f80a4281459
Sha1:   21d7d23b5082cfbd7662ecf888a9879cef5e3b6d
Sha256: a6690102b24638424202c679e3c3fafe83bdaa641e40dca06968bcad77f70821
                                            GET /dispute/americafirstcom/adobe/data/js/css/78bdeddcd621c8d0d38dce1c2bfedd9330602f96.png HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: image
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: image/png
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 2913
Keep-Alive: timeout=5, max=99
Connection: Keep-Alive

--- Additional Info ---
Magic:  PNG image data, 99 x 40, 8-bit/color RGBA, non-interlaced\012- data
Size:   2913
Md5:    6265054874bcf3c370bef6bb64646fe9
Sha1:   78bdeddcd621c8d0d38dce1c2bfedd9330602f96
Sha256: df808b2ea829eac97e99d46d91fa6a005269d58a9dfd57ff40f7084e6f027f7b
                                            GET /dispute/americafirstcom/adobe/data/js/css/368f9486f1d69178fbf8bf2dcfbc491b23e4b261.png HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: image
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: image/png
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:52 GMT
Accept-Ranges: bytes
Content-Length: 3580
Keep-Alive: timeout=5, max=99
Connection: Keep-Alive

--- Additional Info ---
Magic:  PNG image data, 277 x 94, 8-bit/color RGBA, non-interlaced\012- data
Size:   3580
Md5:    aa3ffca4509491de728b7f7e60a7ef63
Sha1:   368f9486f1d69178fbf8bf2dcfbc491b23e4b261
Sha256: 83b34f00b6612015c941c3865d2c047ae5ce567f13530491ac4ed773b13b1bd3
                                            GET /dispute/americafirstcom/adobe/data/js/css/logo-desktop-inverse.a3a99f3a.png HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: image
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: image/png
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 8898
Keep-Alive: timeout=5, max=99
Connection: Keep-Alive

--- Additional Info ---
Magic:  PNG image data, 390 x 134, 8-bit/color RGBA, non-interlaced\012- data
Size:   8898
Md5:    a3a99f3aea38a0574c84d332fc5f871f
Sha1:   5a3bcb4c445e47551ad7fb98a1d57a34432c298d
Sha256: c9a0078a7b8e70e1437317247095c89510a6c40bdb3bb37a26318133e2c1ab54
                                            GET /dispute/americafirstcom/asset/analytics/ads/js/loading.gif HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: image
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: image/gif
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sat, 11 Aug 2018 13:03:52 GMT
Accept-Ranges: bytes
Content-Length: 38636
Keep-Alive: timeout=5, max=100
Connection: Keep-Alive

--- Additional Info ---
Magic:  GIF image data, version 89a, 200 x 200\012- data
Size:   38636
Md5:    d10ef01e81faa2c2d812bdf670b4e072
Sha1:   77d09a57b2091fd7665dff763a5eab23e0ff907e
Sha256: 5e3d5246b17e19e65385092db07554d8e1c5c4a226a6d7f97824b8e1e8571e34
                                            GET /dispute/americafirstcom/adobe/data/js/css/roboto-latin-500.020c97dc.woff2 HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: application/font-woff2;q=1.0,application/font-woff;q=0.9,*/*;q=0.8
Accept-Language: en-US,en;q=0.5
Accept-Encoding: identity
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/adobe/data/js/css/chunk-vendors.eab46e62.css
Sec-Fetch-Dest: font
Sec-Fetch-Mode: cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: font/woff2
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 15872
Keep-Alive: timeout=5, max=98
Connection: Keep-Alive

--- Additional Info ---
Magic:  Web Open Font Format (Version 2), TrueType, length 15872, version 1.0\012- data
Size:   15872
Md5:    020c97dc8e0463259c2f9df929bb0c69
Sha1:   8f956a31154047d1b6527b63db2ecf0f3a463f24
Sha256: 24369e1b2461af9dcefecaf9cc93d64cf22a4c5bac32506100b9e21014507bcf

    - fortinet: Phishing
                                            GET /dispute/americafirstcom/adobe/data/js/css/d4c16de980048679c0662f782e29945ab5125717.png HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: image
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: image/png
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 3311
Keep-Alive: timeout=5, max=98
Connection: Keep-Alive

--- Additional Info ---
Magic:  PNG image data, 250 x 54, 8-bit/color RGBA, non-interlaced\012- data
Size:   3311
Md5:    cf4f20bf0af1f7b4b77126ac20180c2c
Sha1:   d4c16de980048679c0662f782e29945ab5125717
Sha256: 986dae282bc4d35f7234bbf7c3eafd4b4bb990b89143be1f5c8a8aa4a04ee2b4
                                            GET /dispute/americafirstcom/adobe/data/js/css/roboto-latin-400.479970ff.woff2 HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: application/font-woff2;q=1.0,application/font-woff;q=0.9,*/*;q=0.8
Accept-Language: en-US,en;q=0.5
Accept-Encoding: identity
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/adobe/data/js/css/chunk-vendors.eab46e62.css
Sec-Fetch-Dest: font
Sec-Fetch-Mode: cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: font/woff2
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 15736
Keep-Alive: timeout=5, max=98
Connection: Keep-Alive

--- Additional Info ---
Magic:  Web Open Font Format (Version 2), TrueType, length 15736, version 1.0\012- data
Size:   15736
Md5:    479970ffb74f2117317f9d24d9e317fe
Sha1:   81c796737cbe44d4a719777f0aff14b73a3efb1e
Sha256: 48c3fa6f86c54f1d9bb519220713d4b0a1f8cd1a589a3c03b9fa82e98ecb13e3

    - fortinet: Phishing
                                            POST / HTTP/1.1 
Host: r3.o.lencr.org
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate
Content-Type: application/ocsp-request
Content-Length: 85
Connection: keep-alive
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/ocsp-response
Server: nginx
Content-Length: 503
ETag: "C17A343CEB786A421F8C3ABFFFAE350E12C92271A69FC88EB8E8BAB568877D6B"
Last-Modified: Fri, 30 Sep 2022 09:00:00 UTC
Cache-Control: public, no-transform, must-revalidate, max-age=4004
Expires: Fri, 30 Sep 2022 23:15:31 GMT
Date: Fri, 30 Sep 2022 22:08:47 GMT
Connection: keep-alive

                                            POST / HTTP/1.1 
Host: r3.o.lencr.org
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate
Content-Type: application/ocsp-request
Content-Length: 85
Connection: keep-alive
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/ocsp-response
Server: nginx
Content-Length: 503
ETag: "C17A343CEB786A421F8C3ABFFFAE350E12C92271A69FC88EB8E8BAB568877D6B"
Last-Modified: Fri, 30 Sep 2022 09:00:00 UTC
Cache-Control: public, no-transform, must-revalidate, max-age=4004
Expires: Fri, 30 Sep 2022 23:15:31 GMT
Date: Fri, 30 Sep 2022 22:08:47 GMT
Connection: keep-alive

                                            POST / HTTP/1.1 
Host: r3.o.lencr.org
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate
Content-Type: application/ocsp-request
Content-Length: 85
Connection: keep-alive
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/ocsp-response
Server: nginx
Content-Length: 503
ETag: "C17A343CEB786A421F8C3ABFFFAE350E12C92271A69FC88EB8E8BAB568877D6B"
Last-Modified: Fri, 30 Sep 2022 09:00:00 UTC
Cache-Control: public, no-transform, must-revalidate, max-age=4004
Expires: Fri, 30 Sep 2022 23:15:31 GMT
Date: Fri, 30 Sep 2022 22:08:47 GMT
Connection: keep-alive

                                            GET /296x148/filters:format(jpeg):quality(60):no_upscale():strip_exif()/https%3A%2F%2Fs3.amazonaws.com%2Fpocket-curatedcorpusapi-prod-images%2F6d906d66-cd90-4963-827e-8d0564c0f787.jpeg HTTP/1.1 
Host: img-getpocket.cdn.mozilla.net
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: null
Connection: keep-alive
Sec-Fetch-Dest: image
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: image/jpeg
server: nginx
content-length: 5106
x-amzn-requestid: a906507c-8820-489c-9978-7d0fd026c862
x-xss-protection: 1; mode=block
access-control-allow-origin: *
strict-transport-security: max-age=63072000; includeSubdomains; preload
x-frame-options: DENY
content-security-policy: default-src 'none'; img-src 'self'; script-src 'self'; style-src 'self'; object-src 'none'
x-amz-apigw-id: ZPd5PE0MIAMF3DA=
x-content-type-options: nosniff
x-amzn-trace-id: Root=1-6336103a-49eb3879088f17bc01d177c7;Sampled=0
x-amzn-remapped-date: Thu, 29 Sep 2022 21:38:02 GMT
x-amz-cf-pop: SEA19-C2
x-cache: Miss from cloudfront
x-amz-cf-id: aeTAqh8D5whTHS3seyOUj7QCNaITUh2ekHG8vNWZlpSeAnqPuFzmcQ==
via: 1.1 41e349e25dc4bc856d0e5d2c162428a0.cloudfront.net (CloudFront), 1.1 57a21088b36c69a83578b5a5579df58e.cloudfront.net (CloudFront), 1.1 google
date: Fri, 30 Sep 2022 21:46:55 GMT
age: 1312
etag: "3481dce8ab711111fc8863d88bee1a887cfd43ac"
cache-control: max-age=3600,public,public
alt-svc: clear
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01, aspect ratio, density 1x1, segment length 16, progressive, precision 8, 296x148, components 3\012- data
Size:   5106
Md5:    13a12db696bc2bf6a6ea2f48f4c1428e
Sha1:   3481dce8ab711111fc8863d88bee1a887cfd43ac
Sha256: 6dae6c9e5de4146e1f528a36a1795225c9731385f13927fc001fb3f9842fe8f1
                                            GET /296x148/filters:format(jpeg):quality(60):no_upscale():strip_exif()/https%3A%2F%2Fs3.amazonaws.com%2Fpocket-curatedcorpusapi-prod-images%2F59da9c68-5ffa-4dc1-adf8-645278cd60ca.jpeg HTTP/1.1 
Host: img-getpocket.cdn.mozilla.net
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: null
Connection: keep-alive
Sec-Fetch-Dest: image
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: image/jpeg
server: nginx
content-length: 10380
x-amzn-requestid: 35ee2a77-159c-4bb4-a825-98c638398586
x-xss-protection: 1; mode=block
access-control-allow-origin: *
strict-transport-security: max-age=63072000; includeSubdomains; preload
x-frame-options: DENY
content-security-policy: default-src 'none'; img-src 'self'; script-src 'self'; style-src 'self'; object-src 'none'
x-amz-apigw-id: ZPdZYHsTIAMFQNQ=
x-content-type-options: nosniff
x-amzn-trace-id: Root=1-63360f6f-4f68073432bcea371c7b8f03;Sampled=0
x-amzn-remapped-date: Thu, 29 Sep 2022 21:34:39 GMT
x-amz-cf-pop: HIO50-C1, SEA19-C2
x-cache: Hit from cloudfront
x-amz-cf-id: IENB0e-e13ywHJKPgyLWn1bGPMMxFLUu3cIUcREjGhxDEMROEL1jBg==
via: 1.1 00f0a41f749793b9dd653153037c957e.cloudfront.net (CloudFront), 1.1 4f3feb5c4393987d42d1971d404d7cea.cloudfront.net (CloudFront), 1.1 google
date: Thu, 29 Sep 2022 22:24:00 GMT
age: 85487
etag: "265840b2d2fc6eb764cc6409b05deee8d77a19c2"
cache-control: max-age=3600,public,public
alt-svc: clear
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01, aspect ratio, density 1x1, segment length 16, progressive, precision 8, 296x148, components 3\012- data
Size:   10380
Md5:    139a144f8cb04ac8aae65f4bad1473e7
Sha1:   265840b2d2fc6eb764cc6409b05deee8d77a19c2
Sha256: 6e0f01b6bdd5a92e92c7b29a6172a2900c68900afd2abba948940621252e0fd8
                                            GET /296x148/filters:format(jpeg):quality(60):no_upscale():strip_exif()/https%3A%2F%2Fs3.amazonaws.com%2Fpocket-curatedcorpusapi-prod-images%2Fb2016911-a1a6-4bdf-a8f3-89e94a0aaff7.jpeg HTTP/1.1 
Host: img-getpocket.cdn.mozilla.net
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: null
Connection: keep-alive
Sec-Fetch-Dest: image
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: image/jpeg
server: nginx
content-length: 7810
x-amzn-requestid: 7f6d92e1-c7b1-4dd2-9efa-52ad324ca19d
x-xss-protection: 1; mode=block
access-control-allow-origin: *
strict-transport-security: max-age=63072000; includeSubdomains; preload
x-frame-options: DENY
content-security-policy: default-src 'none'; img-src 'self'; script-src 'self'; style-src 'self'; object-src 'none'
x-amz-apigw-id: ZMK6pFvkoAMF_yA=
x-content-type-options: nosniff
x-amzn-trace-id: Root=1-6334beaa-362b7368566955966db78385;Sampled=0
x-amzn-remapped-date: Wed, 28 Sep 2022 21:37:46 GMT
x-amz-cf-pop: SEA73-P1
x-cache: Hit from cloudfront
x-amz-cf-id: 24LX-CT34ANsW2VajOWyq5zihPRuCXVgf2UwZPURnB-Tl0Tw4SKXkA==
via: 1.1 f13aef0c4b52f6f681401f232d03eb68.cloudfront.net (CloudFront), 1.1 ebe4011a81a36e2bf678f69ce1711330.cloudfront.net (CloudFront), 1.1 google
date: Fri, 30 Sep 2022 04:12:56 GMT
age: 64551
etag: "31b8538deb0f00d5b4182739a4a2fcc1b956a998"
cache-control: max-age=3600,public,public
alt-svc: clear
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01, aspect ratio, density 1x1, segment length 16, progressive, precision 8, 296x148, components 3\012- data
Size:   7810
Md5:    456968f691ae9464d69a37bffe9bd7ce
Sha1:   31b8538deb0f00d5b4182739a4a2fcc1b956a998
Sha256: 5cde1e3158e6c6c0b7a01d3bd32f2aa292b3b205f604e5c4ed71cafedad06bf2
                                            GET /296x148/filters:format(jpeg):quality(60):no_upscale():strip_exif()/https%3A%2F%2Fs3.amazonaws.com%2Fpocket-curatedcorpusapi-prod-images%2F98c23448-09e3-4c05-86c5-dafbe6ca8a0e.jpeg HTTP/1.1 
Host: img-getpocket.cdn.mozilla.net
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: null
Connection: keep-alive
Sec-Fetch-Dest: image
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: image/jpeg
server: nginx
content-length: 8059
x-amzn-requestid: f8bb9e4b-9f3c-47ba-8524-de16155e536d
x-xss-protection: 1; mode=block
access-control-allow-origin: *
strict-transport-security: max-age=63072000; includeSubdomains; preload
x-frame-options: DENY
content-security-policy: default-src 'none'; img-src 'self'; script-src 'self'; style-src 'self'; object-src 'none'
x-amz-apigw-id: ZNepwHAVoAMFvNA=
x-content-type-options: nosniff
x-amzn-trace-id: Root=1-633544a4-5d884e29378635b60592b618;Sampled=0
x-amzn-remapped-date: Thu, 29 Sep 2022 07:09:24 GMT
x-amz-cf-pop: HIO50-C1, SEA73-P1
x-cache: Hit from cloudfront
x-amz-cf-id: NMiKZSkokVXNTV76vsVJ7VEu6YFfT9MqL7tHtT8CwZq0BwTbXOpm6Q==
via: 1.1 000f4a2f631bace380a0afa747a82482.cloudfront.net (CloudFront), 1.1 ead78c395f4bede3ec6cd7ea180e3d3a.cloudfront.net (CloudFront), 1.1 google
date: Fri, 30 Sep 2022 04:58:47 GMT
age: 61800
etag: "86dd3bf133e9eddf8852f39e1ee695ee599ac886"
cache-control: max-age=3600,public,public
alt-svc: clear
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01, aspect ratio, density 1x1, segment length 16, progressive, precision 8, 296x148, components 3\012- data
Size:   8059
Md5:    d21d2bdcedbd619a80017054076319f9
Sha1:   86dd3bf133e9eddf8852f39e1ee695ee599ac886
Sha256: fc5672d5a8e9c6a5ec531f7ba05b65c192af37edf6c3a48105df3685de44ec0d
                                            GET /296x148/filters:format(jpeg):quality(60):no_upscale():strip_exif()/https%3A%2F%2Fs3.amazonaws.com%2Fpocket-curatedcorpusapi-prod-images%2Fe12af206-9f17-40de-9764-14d3cdcb4d2f.jpeg HTTP/1.1 
Host: img-getpocket.cdn.mozilla.net
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: null
Connection: keep-alive
Sec-Fetch-Dest: image
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: image/jpeg
server: nginx
content-length: 6722
x-amzn-requestid: 6aca2e04-02b4-4e42-8bba-9bbe2ace1ed0
x-xss-protection: 1; mode=block
access-control-allow-origin: *
strict-transport-security: max-age=63072000; includeSubdomains; preload
x-frame-options: DENY
content-security-policy: default-src 'none'; img-src 'self'; script-src 'self'; style-src 'self'; object-src 'none'
x-amz-apigw-id: ZPeLrGq1oAMFuAw=
x-content-type-options: nosniff
x-amzn-trace-id: Root=1-633610b0-65b0664d0233107029ef0157;Sampled=0
x-amzn-remapped-date: Thu, 29 Sep 2022 21:40:00 GMT
x-amz-cf-pop: SEA73-P1
x-cache: Hit from cloudfront
x-amz-cf-id: DClqs8vTlqibRwXU8dIkkFCUxigTLduturaxCfuvsMtDm-4VXjx2mg==
via: 1.1 4dde8ec6d6c12741888c2d3a059d4a2e.cloudfront.net (CloudFront), 1.1 09331f0822fc98eebaf04130a83dbd44.cloudfront.net (CloudFront), 1.1 google
date: Fri, 30 Sep 2022 21:47:16 GMT
age: 1291
etag: "3248ca3a8b88efd5be8499898fce957d096cf211"
cache-control: max-age=3600,public,public
alt-svc: clear
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01, aspect ratio, density 1x1, segment length 16, progressive, precision 8, 296x148, components 3\012- data
Size:   6722
Md5:    5b8d0a19bc0a56bb40a975c5c71af05a
Sha1:   3248ca3a8b88efd5be8499898fce957d096cf211
Sha256: da44d6dd845dc400b0b76f19c67e5a79d9359ce24fe5e4490477f195b23203b4
                                            GET /296x148/filters:format(jpeg):quality(60):no_upscale():strip_exif()/https%3A%2F%2Fs3.amazonaws.com%2Fpocket-curatedcorpusapi-prod-images%2F9789cead-4e6c-4a12-9b45-25d0efd38fc9.png HTTP/1.1 
Host: img-getpocket.cdn.mozilla.net
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: null
Connection: keep-alive
Sec-Fetch-Dest: image
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: image/jpeg
server: nginx
content-length: 16011
x-amzn-requestid: d58dfdcd-383a-45ac-8ae2-2b97f016b6a4
x-xss-protection: 1; mode=block
access-control-allow-origin: *
strict-transport-security: max-age=63072000; includeSubdomains; preload
x-frame-options: DENY
content-security-policy: default-src 'none'; img-src 'self'; script-src 'self'; style-src 'self'; object-src 'none'
x-amz-apigw-id: ZPdbjFy1IAMF84A=
x-content-type-options: nosniff
x-amzn-trace-id: Root=1-63360f7c-1ca9707a5e5087fd769d9ab6;Sampled=0
x-amzn-remapped-date: Thu, 29 Sep 2022 21:34:52 GMT
x-amz-cf-pop: HIO50-C1, SEA19-C2
x-cache: Hit from cloudfront
x-amz-cf-id: f7RrSV82yxUNWPUohKYX-_PBShMw7Qk82bepr3WAGkzHTjLR-gIXBA==
via: 1.1 28a7186077f9b5270d98dd053f31303e.cloudfront.net (CloudFront), 1.1 ee8246c5442dace7525c74f6a799bb46.cloudfront.net (CloudFront), 1.1 google
date: Thu, 29 Sep 2022 22:53:34 GMT
age: 83713
etag: "78b798f2cfa7db13a6b5ca2ca2783bece5e77d5d"
cache-control: max-age=3600,public,public
alt-svc: clear
X-Firefox-Spdy: h2

--- Additional Info ---
Magic:  JPEG image data, JFIF standard 1.01, aspect ratio, density 1x1, segment length 16, progressive, precision 8, 296x148, components 3\012- data
Size:   16011
Md5:    1389b1d624b44706c7a6f6b7eb769241
Sha1:   78b798f2cfa7db13a6b5ca2ca2783bece5e77d5d
Sha256: c3c2526b98be06fc7e793e1150bacde2a7bd718e29a851a6e6992e8d84333790
                                            GET /dispute/americafirstcom/adobe/data/js/css/favicon.ico HTTP/1.1 
Host: messepost-online.de
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: image/avif,image/webp,*/*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Connection: keep-alive
Referer: https://messepost-online.de/dispute/americafirstcom/
Sec-Fetch-Dest: image
Sec-Fetch-Mode: no-cors
Sec-Fetch-Site: same-origin

HTTP/1.1 200 OK
Content-Type: image/x-icon
Date: Fri, 30 Sep 2022 22:08:46 GMT
Server: Apache
Last-Modified: Sun, 20 Feb 2022 11:38:54 GMT
Accept-Ranges: bytes
Content-Length: 1150
Keep-Alive: timeout=5, max=97
Connection: Keep-Alive

--- Additional Info ---
Magic:  MS Windows icon resource - 1 icon, 16x16, 32 bits/pixel\012- data
Size:   1150
Md5:    5f0fb15bba173e0aa54bd6434418f8fe
Sha1:   fc16c82f44707eb5045be0f68cfcfce4a4ac29d9
Sha256: 0534a1a2f971f20a153479d5e01ad4051a8af96221bb5f7c80ff06a759d1ea2e
                                            GET /bootstrap/4.1.0/js/bootstrap.min.js HTTP/1.1 
Host: stackpath.bootstrapcdn.com
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:96.0) Gecko/20100101 Firefox/96.0
Accept: */*
Accept-Language: en-US,en;q=0.5
Accept-Encoding: gzip, deflate, br
Origin: https://messepost-online.de
Connection: keep-alive
Referer: https://messepost-online.de/
Sec-Fetch-Dest: script
Sec-Fetch-Mode: cors
Sec-Fetch-Site: cross-site

HTTP/2 200 OK
content-type: application/javascript; charset=utf-8
date: Fri, 30 Sep 2022 22:08:46 GMT
vary: Accept-Encoding
cdn-pullzone: 252412
cdn-uid: b1941f61-b576-4f40-80de-5677acb38f74
cdn-requestcountrycode: DE
access-control-allow-origin: *
cache-control: public, max-age=31919000
etag: W/"ce6e785579ae4cb555c9de311d1b9271"
last-modified: Mon, 25 Jan 2021 22:04:05 GMT
cdn-cachedat: 08/20/2022 03:07:07
cdn-proxyver: 1.02
cdn-requestpullcode: 200
cdn-requestpullsuccess: True
cdn-edgestorageid: 601
cdn-status: 200
timing-allow-origin: *
cross-origin-resource-policy: cross-origin
x-content-type-options: nosniff
cdn-requestid: 18437709eec1457e1ae40b284ffa8f31
cdn-cache: HIT
cf-cache-status: HIT
strict-transport-security: max-age=31536000; includeSubDomains; preload
server: cloudflare
cf-ray: 75304770bfebb50b-OSL
content-encoding: br
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400
X-Firefox-Spdy: h2

--- Additional Info ---